KEGG   Bacillus subtilis subsp. subtilis 168: BSU40990Help
Entry
BSU40990          CDS       T00010                                 

Gene name
noc
Definition
(RefSeq) nucleoid occlusion protein
  KO
K03497  ParB family transcriptional regulator, chromosome partitioning protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU40990 (noc)
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU40990 (noc)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bsu04812]
    BSU40990 (noc)
Transcription factors [BR:bsu03000]
 Prokaryotic Type
  Other transcription factors
   Others
    BSU40990 (noc)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    BSU40990 (noc)
Cytoskeleton proteins [BR:bsu04812]
 Prokaryotic cytoskeleton proteins
  MinD / ParA class of bacterial cytoskeletal proteins
   BSU40990 (noc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ParBc HTH_ParB HTH_3 HTH_50 KorB TrmB HTH_38
Motif
Other DBs
NCBI-GeneID: 937920
NCBI-ProteinID: NP_391979
Pasteur: BG10057
BSORF: BG10057
UniProt: P37524
Position
complement(4207897..4208748)
Genome map
AA seq 283 aa AA seqDB search
MKHSFSRFFGLGEKEQEPEIAEHDTNKEEILEIPVNAIVPNRFQPRTIFSDEKIKELAMT
IHTHGIIQPIVVRHTEEEGQYELIAGERRWRAVQSLEWEKIPAIIKDFSDTETASVALIE
NLQREELSSIEEAHAYARLLELHDLTQEALAQRLGKGQSTIANKLRLLKLPQPVQEAIME
KKITERHARALIPLKQPELQVTLLTEIIEKSLNVKQTEDRVVKMLEQGQRKPKPRRKAFS
RDTRIAMNTIRQSLSMVEDSGVKLNTEEEEFEEYIQLTIRIPK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaagcattcattctctcgtttcttcgggcttggtgagaaggaacaggagccggagatt
gctgaacatgatacaaacaaagaagagattctggaaataccggtaaatgctatcgttccc
aaccgttttcagccacgcaccattttctcagatgaaaaaatcaaagagttagcaatgacc
attcatacacacggcattattcagccgattgttgttaggcatacagaagaagaaggccaa
tacgaactcattgcaggtgaaagacgctggagagcggtgcaatcgcttgagtgggaaaag
attccggcaattattaaggatttttccgacacggaaaccgcttctgtggcgttaatcgaa
aacttgcagcgggaagaactgtcttctattgaggaagcgcatgcttatgctaggctgctt
gagctgcatgatttaacacaggaggcactcgcacagcgcttaggaaaagggcagtctaca
atcgcgaataagcttcggttattaaagctgcctcagccggtccaagaggcgattatggag
aagaaaatcaccgagcgccatgccagagcactgattccgctgaaacagcctgagctccaa
gtcacactgctcacagagattattgagaaaagtttaaatgtaaagcagacagaagaccgc
gtggtgaaaatgctggagcaaggccagagaaagccaaagccgagacgcaaagcattcagc
agagatacaagaattgcgatgaacacgattcgccagtcactatcaatggtggaagacagc
ggtgtaaaattgaatacggaagaagaagaatttgaagaatatattcaattaacgattcgc
ataccaaaatag

DBGET integrated database retrieval system