KEGG   Bacillus subtilis subsp. subtilis 168: BSU41000Help
Entry
BSU41000          CDS       T00010                                 

Gene name
gidB
Definition
(RefSeq) ribosomal RNA small subunit methyltransferase G
  KO
K03501  16S rRNA (guanine527-N7)-methyltransferase [EC:2.1.1.170]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU41000 (gidB)
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU41000 (gidB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.170  16S rRNA (guanine527-N7)-methyltransferase
     BSU41000 (gidB)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic Type
  rRNA modification factors
   16S rRNA modification factors
    BSU41000 (gidB)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    BSU41000 (gidB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GidB Methyltransf_31 MTS Methyltransf_25 Methyltransf_2 Methyltransf_12 Methyltransf_32
Motif
Other DBs
NCBI-GeneID: 937931
NCBI-ProteinID: NP_391980
Pasteur: BG10058
BSORF: BG10058
UniProt: P25813
Structure
PDB: 

Position
complement(4208870..4209589)
Genome map
AA seq 239 aa AA seqDB search
MNIEEFTSGLAEKGISLSPRQLEQFELYYDMLVEWNEKINLTSITEKKEVYLKHFYDSIT
AAFYVDFNQVNTICDVGAGAGFPSLPIKICFPHLHVTIVDSLNKRITFLEKLSEALQLEN
TTFCHDRAETFGQRKDVRESYDIVTARAVARLSVLSELCLPLVKKNGLFVALKAASAEEE
LNAGKKAITTLGGELENIHSFKLPIEESDRNIMVIRKIKNTPKKYPRKPGTPNKSPIEG
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgaagaattcacttctggtttggcggaaaaagggatctccctttctccccgt
cagctggagcaatttgagctgtattacgacatgctggttgaatggaacgaaaaaatcaat
ctgacttcaataacagagaaaaaagaagtgtatttaaagcatttttatgattccattaca
gctgctttttatgtcgacttcaatcaggtgaacacgatttgtgatgttggagcgggagcg
ggttttccaagtctgccgataaaaatatgctttccgcacctccatgtcacaatcgtggat
tcactaaacaaacggattacgtttttagaaaagttgtctgaagctttgcaattggagaat
acaacattctgccatgacagagctgaaacgttcgggcaacggaaagacgtgcgtgaaagc
tatgatattgtgacggcgcgcgcagttgcgagattatctgttttgagtgagctttgcttg
cctctggtgaagaaaaacggtttatttgttgctttaaaagccgcatcagctgaagaagaa
ctgaatgcaggcaaaaaagcaatcacgacgcttggaggagaacttgagaatatccattct
tttaagctgcctattgaagaaagcgatcgtaatattatggtgatacgcaaaataaaaaat
acacctaagaagtatccaagaaaaccgggaactcctaataaatcgccaattgaagggtaa

DBGET integrated database retrieval system