KEGG   Bacillus subtilis subsp. subtilis 168: BSU41010Help
Entry
BSU41010          CDS       T00010                                 

Gene name
gidA
Definition
(RefSeq) tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG
  KO
K03495  tRNA uridine 5-carboxymethylaminomethyl modification enzyme
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU41010 (gidA)
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU41010 (gidA)
Transfer RNA biogenesis [BR:bsu03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    BSU41010 (gidA)
 Prokaryotic Type
    BSU41010 (gidA)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    BSU41010 (gidA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GIDA GIDA_assoc FAD_binding_2 Pyr_redox_2 FAD_oxidored Pyr_redox_3 HI0933_like AlaDh_PNT_C Thi4 Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 937932
NCBI-ProteinID: NP_391981
Pasteur: BG10059
BSORF: BG10059
UniProt: P25812
Position
complement(4209603..4211489)
Genome map
AA seq 628 aa AA seqDB search
MGYEAGQYDVIVIGAGHAGVEAALASARQGAKTLVLTINLDMVAFMPCNPSVGGPAKGIV
VREIDALGGEMGRNIDKTHIQMRMLNTGKGPAVRALRAQADKFQYQHEMKNTLEKEPNLT
LLQGIVERLIVEDGECRGVITQTGAHYRAKAVVMTTGTYLRGRIILGDLSYSSGPNNQQP
SIKLSEHLEELGFDLVRFKTGTPPRVKSDTIDYSKTEIQPGDDVPRAFSYETVEYITDQL
PCWLTYTSPETHEIIDSNLHRSPMYSGMIKGTGPRYCPSIEDKVVRFNDKPRHQIFLEPE
GRNTQEVYVQGLSTSLPEDVQQRMLATIPGLENVQMMRAGYAIEYDAIVPTQLWPTLETK
KITNLYTAGQINGTSGYEEAAGQGIMAGINAGRKALGKEEVILSRSDAYIGVLIDDLVTK
GTNEPYRLLTSRAEYRLLLRHDNADLRLTEIGHRIGLISDERYAAFEKKKAAIEAEKKRL
HSVIIKPSPENQEYIRSLGGSELKDGVRGTDLMKRPEMNYETVTKLAPPEVPVPQDVAEQ
VEIQVKYEGYIEKSLQQVEKLKKMENKKIPDRIDYDAIKGIATEARQKLKNVRPLSVAQA
SRISGVNPADISILLVYLEQGRIAKIAE
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggggtatgaagcaggccaatacgatgtgattgtgattggcgccgggcatgccggtgtt
gaggctgccctcgcatctgcacgccaaggcgccaaaacgcttgtcttgaccatcaaccta
gatatggttgcatttatgccatgtaatccgtctgtcggcggccccgcaaaagggattgtc
gtccgcgaaattgacgcgctcggcggagaaatgggaagaaacatcgataaaacacatatt
caaatgagaatgctgaatacaggaaaaggtcctgcggttcgtgcattgcgtgcgcaagca
gacaaattccaatatcagcacgaaatgaaaaatacgcttgaaaaagaaccaaacttaaca
ttgctgcaaggaattgtggagcggctgatcgttgaagacggcgaatgccgaggcgttatt
acacaaacaggcgcacattatcgtgcgaaagcagttgtcatgacgacagggacatattta
agaggacgtatcattcttggcgatctgtcttactcaagcggcccgaataaccagcagcct
tctattaagctttctgagcatttggaggaactcggttttgaccttgttcgttttaaaaca
ggtacgccgcctcgcgttaaaagcgacacgattgattacagcaaaacggaaattcagcct
ggtgacgatgtgcctcgcgctttctcatatgaaacagtggaatatatcacagatcagctc
ccttgctggctgacatatacaagccctgagacacatgagattattgacagcaacctgcac
cgttcaccgatgtattccggtatgatcaaaggtacgggcccaagatactgcccatccatt
gaagacaaagttgtccgttttaatgataaaccgcgtcaccaaatcttccttgagccggaa
ggcagaaatacacaggaagtctatgtccaaggtttatctacaagtcttccagaagacgta
cagcaaagaatgcttgcaacgattcctggacttgaaaacgtgcaaatgatgagagccggc
tatgcgatcgagtatgatgcaatcgtaccgacacagctatggccgacacttgaaaccaaa
aaaatcacaaacctttatactgcaggccaaattaacggaacatccggttatgaagaagct
gcgggacaagggattatggcgggaatcaatgcaggacgaaaagcgcttggaaaagaagaa
gtaattctaagccgttctgacgcctatattggtgttctgattgatgaccttgtgacaaaa
ggtaccaatgagccatatcgtcttttgacatcacgtgcggaatacagattgctgcttcgc
catgacaatgctgatttgcgtctgacagaaatcggacatcgcattggattgatttctgat
gagcgctatgcggcttttgagaagaaaaaagcggcgatcgaggcggagaaaaaacgtctt
cattctgtaattatcaagccgtctccggaaaatcaagaatatatccgttctcttggcgga
agcgaattgaaagatggagttcgcggcacagacttgatgaaacgtcctgaaatgaactat
gaaacagtcacaaaactggcgccgccagaagtgccggttcctcaagacgtggcagaacaa
gtagaaatccaagtgaaatatgaaggatatattgaaaaatctcttcagcaagtggaaaaa
ctgaagaagatggaaaataaaaaaattccagaccgaattgattatgacgcaattaagggg
attgcgaccgaggcgcgtcaaaaactgaaaaatgtacggcctttgtctgttgcccaggct
tcccgcatttccggtgtaaacccggcggacatttcaattctattggtgtatttagagcag
ggacgcattgcgaagatagccgagtag

DBGET integrated database retrieval system