KEGG   Bacillus subtilis subsp. subtilis 168: BSU41020Help
Entry
BSU41020          CDS       T00010                                 

Gene name
trmE
Definition
(RefSeq) tRNA modification GTPase MnmE
  KO
K03650  tRNA modification GTPase [EC:3.6.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU41020 (trmE)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.-  Acting on acid anhydrides
    3.6.-.-  
     BSU41020 (trmE)
Transfer RNA biogenesis [BR:bsu03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    BSU41020 (trmE)
 Prokaryotic Type
   Methyltransferases
    BSU41020 (trmE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MnmE_helical TrmE_N MMR_HSR1 FeoB_N Dynamin_N RsgA_GTPase AIG1 Ras MMR_HSR1_Xtn Roc AAA_16 Cyc-maltodext_C
Motif
Other DBs
NCBI-GeneID: 937927
NCBI-ProteinID: NP_391982
Pasteur: BG10060
BSORF: BG10060
UniProt: P25811
Position
complement(4211510..4212889)
Genome map
AA seq 459 aa AA seqDB search
MDTIAAISTPMGEGAIAIVRLSGPEAIQIADKIYKGPKGKTLSSVESHTIHYGHIVDRPS
DRVVEEVMVSVLKAPRTFTREDVIEINCHGGIVTVNQVLQLALREGARLAEPGEFTKRAF
LNGRIDLSQAEAVMDLIRAKTDRAMNVAMNQMEGRLSALVRRLRSEILETLAHVEVNIDY
PEYDDVEEMTHQILVEKATAVKKEIETLLRTSEQGKILREGLSTVIIGRPNVGKSSLLNS
LVHEAKAIVTDIPGTTRDVIEEYVNVRGVPLRLVDTAGIRETEDIVERIGVERSRQVLKE
ADLILLVLNYSEELSEEDVKLFEAVEGMDVIVILNKTDLEPKIDTERVRELANGRPVVTT
SLLKEEGINDLEEAIQSLFYTGAIESGDLTYVSNTRHITILQQAKRAIEDALSGIEQDVP
IDMVQIDLTRCWELLGEIIGDSVHESLIDQLFSQFCLGK
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggatacaattgcggcaatttccacaccgatgggagaaggcgcgattgcgattgtacgg
ttgagcggaccagaagccattcaaatcgcagataaaatttataagggaccgaaggggaaa
acactcagctcggtcgaatcacatacgattcattatggtcatatcgtagacagaccttcg
gatcgtgtcgttgaggaagtaatggtatcagtgttaaaagcgccgagaacttttacacga
gaagatgtcatcgagattaactgtcacgggggaattgtgactgtgaaccaagtgcttcag
cttgcattgagagagggagcgagactggcagagcctggtgaatttacgaaacgtgcgttt
ttaaacggccgaatcgatctttcacaggcggaagcggttatggacttaatcagagcgaaa
acggaccgggcaatgaacgttgctatgaatcaaatggaagggcgtctttctgctttggtg
cgccgtttgcgcagtgagattttagaaacactggcccatgttgaggtgaatattgattat
ccggagtatgatgatgtagaggaaatgacgcatcagattttagtcgaaaaggcaaccgcc
gtgaaaaaggaaattgagacgctgctgaggacttctgagcaaggaaaaatcttgcgtgaa
ggtctttctaccgtcattatcggccggccaaacgtaggaaaatcatctcttctgaacagc
ctcgttcatgaggcaaaagccattgtaaccgatattcccggaacgacacgggatgtgatt
gaggaatacgtgaatgtaaggggcgttccgcttcgtctggttgatacagcaggtattcgt
gaaacagaggatattgttgagcgaatcggtgttgaacgttctcgccaggtcctaaaggaa
gcggacctgattttacttgtgcttaattatagtgaagagctttctgaagaagacgtgaag
ctttttgaagccgttgagggcatggatgttatcgtgattttgaataagactgaccttgag
ccgaagattgacactgaacgtgtccgtgagcttgccaatggacgtccagttgttacgaca
tctcttttaaaagaggaaggcatcaatgatctggaagaagcgattcaatcactgttctac
acgggtgccattgaaagcggtgatctgacttatgtcagcaacacacgtcacatcactatt
ttacagcaagcaaaacgcgccattgaagatgcgcttagcggcatcgaacaggatgtcccg
atcgacatggtgcaaattgaccttacaagatgctgggagcttttaggggaaatcattgga
gattctgtccacgaaagcttaattgatcagctcttttctcaattctgtttaggaaaataa

DBGET integrated database retrieval system