KEGG   Bacillus subtilis subsp. subtilis 168: BSU41030Help
Entry
BSU41030          CDS       T00010                                 

Gene name
jag
Definition
(RefSeq) protein jag
  KO
K06346  spoIIIJ-associated protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU41030 (jag)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Jag_N R3H KH_4 KH_2 KH_1
Motif
Other DBs
NCBI-GeneID: 937933
NCBI-ProteinID: NP_391983
Pasteur: BG10061
BSORF: BG10061
UniProt: Q01620
Position
complement(4213200..4213826)
Genome map
AA seq 208 aa AA seqDB search
MRNVTAAGRNVDEAVQSGLQELGLTKDKVEITVIEEGNKGFLGIFGKKPAIVKLVEKIDP
IQQAKLYLQTIAEAIAGKSDVTVQESKKTVRYHITGEKAALLIGKRGQTLNALETLTQLA
LNRYPGQYKNVTVDAENYRLKRKETLSQLAIKLADQVLKTKKSIQLEPMPSSERKIIHDT
LSGYANHQIKTYSMGEGENRHLVISHKR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
gtgaggaatgtgactgctgcagggcgaaatgtcgatgaagcagtacagtccggattgcaa
gagttgggattaacgaaggataaggtagaaattactgttattgaagagggaaacaaaggg
tttctcggtattttcggtaaaaagcctgcgatcgtaaagctggttgaaaagattgatccg
attcagcaagcgaagttatatcttcaaacgattgccgaagccattgccgggaagtctgat
gtgactgttcaagaaagcaaaaagacagtgagatatcatataacaggtgaaaaggcagca
ttgttgattgggaaaagaggacaaactttaaacgcccttgaaactttgacacagcttgcc
cttaaccgttatccaggccaatataaaaatgtgacggtggatgcagaaaactatcgtttg
aaaagaaaagaaacactgagccagctggccatcaagcttgctgaccaggttttgaaaacg
aaaaaatccatccagcttgagcccatgccgtccagcgaaagaaaaattattcacgatact
ctttctggatatgcaaaccaccagatcaaaacatattcaatgggtgaaggcgaaaatcgt
catctcgttatttcccataaaagatag

DBGET integrated database retrieval system