KEGG   Bacillus subtilis subsp. subtilis 168: BSU41040Help
Entry
BSU41040          CDS       T00010                                 

Gene name
spoIIIJ
Definition
(RefSeq) membrane protein insertase MisCA
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02024  Quorum sensing
bsu03060  Protein export
bsu03070  Bacterial secretion system
Module
bsu_M00335  Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BSU41040 (spoIIIJ)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BSU41040 (spoIIIJ)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU41040 (spoIIIJ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bsu03029]
    BSU41040 (spoIIIJ)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU41040 (spoIIIJ)
Mitochondrial biogenesis [BR:bsu03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    BSU41040 (spoIIIJ)
Secretion system [BR:bsu02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   BSU41040 (spoIIIJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 60KD_IMP LAP1C DUF3600 Got1
Motif
Other DBs
NCBI-GeneID: 937934
NCBI-ProteinID: NP_391984
Pasteur: BG10062
BSORF: BG10062
UniProt: Q01625
Position
complement(4213823..4214608)
Genome map
AA seq 261 aa AA seqDB search
MLLKRRIGLLLSMVGVFMLLAGCSSVKEPITADSPHFWDKYVVYPLSELITYVAKLTGDN
YGLSIILVTILIRLLILPLMIKQLRSSKAMQALQPEMQKLKEKYSSKDQKTQQKLQQETM
ALFQKHGVNPLAGCFPILIQMPILIGFYHAIMRTQAISEHSFLWFDLGEKDPYYILPIVA
GVATFVQQKLMMAGNAQQNPQMAMMLWIMPIMIIVFAINFPAALSLYWVVGNLFMIAQTF
LIKGPDIKKNPEPQKAGGKKK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgttgttgaaaaggagaatagggttgctattaagtatggttggcgtattcatgcttttg
gctggatgctcgagtgtgaaagagccgatcactgcagatagtccgcatttctgggacaag
tacgtagtatatccattgtctgagctcattacgtatgtagcgaaattgacgggagataac
tacgggctttcaattattctagttaccattttaattcgtttattaattttaccgctgatg
attaagcagctgagaagttcgaaagcgatgcaggctttacagccggaaatgcaaaagctt
aaagaaaaatacagctcaaaggatcaaaaaacgcagcaaaagcttcaacaggaaacaatg
gctttattccaaaagcatggtgtcaatccattggcgggatgtttcccgattttgatccag
atgccgattttaattggattctatcatgcgatcatgagaacccaggcgatttcagagcat
agcttcttatggtttgacttaggagaaaaagatccttactatattcttcctatcgttgcc
ggtgtcgctacatttgttcagcaaaaactgatgatggctggcaatgcgcagcaaaatccg
caaatggcgatgatgctttggattatgccaattatgattatcgtatttgcgatcaacttc
ccggcggctctttctctttattgggtagttggtaacttgtttatgattgcgcaaactttc
ctcattaaaggacctgatattaaaaaaaatcctgagccgcaaaaagccggaggaaagaaa
aagtga

DBGET integrated database retrieval system