KEGG   Bacillus subtilis subsp. subtilis 168: BSU41050Help
Entry
BSU41050          CDS       T00010                                 

Gene name
rnpA
Definition
(RefSeq) ribonuclease P protein component
  KO
K03536  ribonuclease P protein component [EC:3.1.26.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU41050 (rnpA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     BSU41050 (rnpA)
Transfer RNA biogenesis [BR:bsu03016]
 Prokaryotic Type
  5'processing factors
   Ribonucrease P
    BSU41050 (rnpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuclease_P RNase_E_G BcsB
Motif
Other DBs
NCBI-GeneID: 937930
NCBI-ProteinID: NP_391985
Pasteur: BG10063
BSORF: BG10063
UniProt: P25814
Structure
PDB: 

Position
complement(4214753..4215103)
Genome map
AA seq 116 aa AA seqDB search
MKKRNRLKKNEDFQKVFKHGTSVANRQFVLYTLDQPENDELRVGLSVSKKIGNAVMRNRI
KRLIRQAFLEEKERLKEKDYIIIARKPASQLTYEETKKSLQHLFRKSSLYKKSSSK
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaagcgaaatcgtttaaagaaaaatgaagattttcaaaaagtgtttaaacatggg
acatcagttgcaaaccgccagtttgtcttatatacgcttgatcagcctgaaaatgatgaa
ctgcgtgtcgggctttccgtcagcaaaaaaattggcaatgctgtgatgcgaaatcggatc
aaacgtttgattcggcaggcctttcttgaagagaaagagagactgaaggaaaaggattac
atcattattgccagaaaaccggcgagccagctgacatatgaggaaacgaaaaaaagtctg
cagcatctattcagaaagtcttcattatataagaaatcttcgtcaaagtag

DBGET integrated database retrieval system