KEGG   Bacillus subtilis subsp. subtilis 168: BSU41060Help
Entry
BSU41060          CDS       T00010                                 

Gene name
rpmH
Definition
(RefSeq) 50S ribosomal protein L34
  KO
K02914  large subunit ribosomal protein L34
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Module
bsu_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU41060 (rpmH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU41060 (rpmH)
Ribosome [BR:bsu03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU41060 (rpmH)
  Bacteria
    BSU41060 (rpmH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L34
Motif
Other DBs
NCBI-GeneID: 937942
NCBI-ProteinID: NP_391986
Pasteur: BG10064
BSORF: BG10064
UniProt: P05647
Structure
PDB: 

Position
complement(4215255..4215389)
Genome map
AA seq 44 aa AA seqDB search
MKRTFQPNNRKRSKVHGFRSRMSSKNGRLVLARRRRKGRKVLSA
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaacattccaaccgaataaccgtaaacgcagcaaagttcatggcttcagaagc
cgtatgagttcaaaaaacggtcgtctagttttagcacgccgtcgccgcaaaggcagaaaa
gtattatcagcttag

DBGET integrated database retrieval system