KEGG   Brucella suis bv. 2 Bs364CITA: BSSP2_I0444Help
Entry
BSSP2_I0444       CDS       T03741                                 

Gene name
ribB
Definition
(GenBank) 3,4-dihydroxy-2-butanone 4-phosphate synthase / GTP cyclohydrolase II
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
bsuc  Brucella suis bv. 2 Bs364CITA
Pathway
bsuc00740  Riboflavin metabolism
bsuc00790  Folate biosynthesis
bsuc01100  Metabolic pathways
bsuc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsuc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BSSP2_I0444 (ribB)
   00790 Folate biosynthesis
    BSSP2_I0444 (ribB)
Enzymes [BR:bsuc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     BSSP2_I0444 (ribB)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     BSSP2_I0444 (ribB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2 PUA
Motif
Other DBs
NCBI-ProteinID: AIB30676
Position
I:443642..444757
Genome map
AA seq 371 aa AA seqDB search
MSYNQKQVVDAIRAFERGEIVVVMDDDGRENEGDLIVAAVHCTPEKMAFIVRHTSGIVCT
PMTREEAKRLNLTPMVAENESAHTTAFTVTVDYRHGTTTGISAEDRTLTVRNLANPNAGA
SDFVRPGHIFPLVAREGGVLMRSGHTEAAVDLCKLANLPPIGVICELVNDDGTVKRGPDV
AAFAEEHKLHRVTVADLIAYRQRKETLVRRIGDAPVETCAGKAHAYSYELPWEPMQHVAV
VFGDIRDGEEVPVRLHREDVLNDVFGKGGSNLDAIMQRMGQEGRGILVYLREGSVGVRSD
HRDARAREALQGEHEAHAEAVAREEEWRQIGLGAQILKDLGVSSIVLLASRELHYVGLEG
FGICITRTEII
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgagctataatcagaaacaggtcgttgatgcgattcgcgcttttgaacgcggtgaaatc
gtcgtggtcatggatgacgacggtcgcgaaaacgaaggcgatctgatcgtcgccgccgtg
cattgcacaccggaaaagatggccttcatcgtgcgccatacgtccggcattgtctgcacg
ccgatgacgcgtgaggaagccaagcgcctcaacctgacgccgatggtggcggaaaacgaa
tccgctcacacgaccgcttttacggtcacggtcgattatcgccatggcaccacgaccggc
atttcagccgaagaccgcacgctgaccgtgcgcaacctggccaatcccaatgccggtgct
tcggatttcgtgcgccccggccatattttcccgctggttgcccgtgagggcggtgtgctg
atgcgctccggccatacggaagccgccgttgatctgtgcaagctcgccaacctgccgccc
atcggcgttatctgcgaactcgtcaacgatgacggcacggtcaagcgcggtcccgatgtg
gcggctttcgccgaggagcacaaattgcaccgcgtcacggttgccgatctcatcgcctat
cgccagcgcaaggaaacgctggtcaggcgcattggcgatgcgcctgtcgaaacctgtgct
ggcaaggctcatgcctatagttatgaactgccgtgggagccgatgcagcatgtggcggtt
gtcttcggcgatattcgcgacggcgaggaagtgccggtccgtctccatcgcgaggatgtg
ctgaacgatgttttcggcaagggcggcagcaatctcgatgccatcatgcagcgcatgggg
caggagggccggggcattctggtctatctgcgtgaaggctccgtcggcgtgcgttcggat
catcgcgatgcccgcgcccgtgaggcgctgcaaggcgagcatgaagcccatgcggaagcc
gttgcccgcgaggaagaatggcgccagatcggccttggcgcgcagattttgaaggatctc
ggcgtttcctccatcgtgcttctggcctcgcgtgagctccactatgtcggccttgaaggt
ttcggcatttgcatcacgcgtacggaaattatctaa

DBGET integrated database retrieval system