KEGG   Brucella suis bv. 2 Bs364CITA: BSSP2_I1643Help
Entry
BSSP2_I1643       CDS       T03741                                 

Definition
(GenBank) 7-alpha-hydroxysteroid dehydrogenase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
bsuc  Brucella suis bv. 2 Bs364CITA
Pathway
bsuc00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:bsuc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    BSSP2_I1643
Enzymes [BR:bsuc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     BSSP2_I1643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase T4SS-DNA_transf 3HCDH_N B12-binding
Motif
Other DBs
NCBI-ProteinID: AIB31851
Position
I:1581604..1582518
Genome map
AA seq 304 aa AA seqDB search
MGADPVYGLPGFGDHEGRTPFKRLQVSDIVAIRTPVRITPDRKAFWRKYMSYESPFHLND
AVAIVTGAAAGIGRAIAGTFAKAGASVVVTDLKSEGAEAVAAAIRQAGGKAIGLECNVTD
EQHREAVIKAALDQFGKITVLVNNAGGGGPKPFDMPMSDFEWAFKLNLFSLFRLSQLAAP
HMQKAGGGAILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGA
IKTDALATVLTPEIERAMLKHTPLGRLGEAQDIANAALFLCSPAAAWISGQVLTVSGGGV
QELD
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccgacccggtttacggattacccggatttggcgaccatgaagggcgaacgccc
tttaagcgccttcaggtctcagatatagttgccatccgcacgccggtccgcatcacgccg
gatcgcaaagccttctggagaaaatatatgtcctatgagagcccgttccacctgaatgat
gctgttgcaatcgtcaccggagcggcggcaggtatcggacgggccatcgccggaaccttc
gccaaggctggtgcttcggttgtcgtaaccgaccttaaaagcgaaggcgctgaagccgtt
gcagccgcaataaggcaagctggcggcaaggccatcgggcttgaatgcaacgtaaccgac
gagcagcatcgcgaagccgtcatcaaagcggccctcgatcagttcggcaaaatcactgtt
ctggtcaacaatgcgggtggaggcggccccaagcccttcgatatgccgatgagcgacttt
gaatgggccttcaagctcaatctcttttccctgtttcgcctgtcgcaattggctgcccca
cacatgcagaaggctggcggcggcgcaattctcaatatttcgtccatggccggagaaaat
accaatgtccggatggcctcctatggttcgtccaaggcggcggtcaatcacctcacccgc
aacattgccttcgatgtcggcccaatgggcattcgcgtgaatgccatcgcgcccggcgcg
atcaagaccgatgcgctcgcaaccgttctgacgcctgaaatcgaacgcgccatgctcaag
cacacgccgcttggccgcctcggcgaagcgcaggatatcgccaatgcggcgctgttcctc
tgttcgcccgccgcagcatggatcagcggtcaggttctcacggtttccggcggcggcgtg
caggaactcgactga

DBGET integrated database retrieval system