KEGG   Brucella suis bv. 2 Bs364CITA: BSSP2_II0623Help
Entry
BSSP2_II0623      CDS       T03741                                 

Definition
(GenBank) Aldehyde dehydrogenase A
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bsuc  Brucella suis bv. 2 Bs364CITA
Pathway
bsuc00010  Glycolysis / Gluconeogenesis
bsuc00053  Ascorbate and aldarate metabolism
bsuc00071  Fatty acid degradation
bsuc00280  Valine, leucine and isoleucine degradation
bsuc00310  Lysine degradation
bsuc00330  Arginine and proline metabolism
bsuc00340  Histidine metabolism
bsuc00380  Tryptophan metabolism
bsuc00410  beta-Alanine metabolism
bsuc00561  Glycerolipid metabolism
bsuc00620  Pyruvate metabolism
bsuc00625  Chloroalkane and chloroalkene degradation
bsuc00903  Limonene and pinene degradation
bsuc01100  Metabolic pathways
bsuc01110  Biosynthesis of secondary metabolites
bsuc01120  Microbial metabolism in diverse environments
bsuc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bsuc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSSP2_II0623
   00053 Ascorbate and aldarate metabolism
    BSSP2_II0623
   00620 Pyruvate metabolism
    BSSP2_II0623
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSSP2_II0623
   00561 Glycerolipid metabolism
    BSSP2_II0623
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSSP2_II0623
   00310 Lysine degradation
    BSSP2_II0623
   00330 Arginine and proline metabolism
    BSSP2_II0623
   00340 Histidine metabolism
    BSSP2_II0623
   00380 Tryptophan metabolism
    BSSP2_II0623
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BSSP2_II0623
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BSSP2_II0623
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BSSP2_II0623
Enzymes [BR:bsuc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BSSP2_II0623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIB32813
Position
II:610564..611607
Genome map
AA seq 347 aa AA seqDB search
MLQKNLIQKTQFYIDGAWRSPVEEKTIEVMNPADEKPYAVISAGSAADIDLAVAAARRAF
PAWSETPAEERIAYIRRIAEIYESRLDEMAKTISMEMGAPIKLARESQAAAGLSHTKAFI
AACENFEVEEVLSPKYPNQTAVHEPIGVCGLITPWNWPMNQITLKVIPAIAVGYTVVLKP
SEIAPMSAMLFAEFVDQAGLPKGVFNLVNGEGPVVGEALSQHPEVDMMSFTGSTRAGTAV
SRAAAATVKRVSLELGGKSPNIVFADSDLEKAISRSLAHCFENTGQSCNAPTRMLVERSV
YDKAVELAKKSSGKHQGRRSGAGRGPYRPAFFLYPVREGSGAHPEGH
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaaaaaaatcttatccagaaaacgcaattctatatcgatggcgcatggcggtct
ccggtagaagaaaagacgatcgaggtgatgaacccggcggatgaaaagccttatgctgtc
atttccgccggttccgcagccgatatagacctggctgttgcagccgcgcgcagggccttc
cctgcctggagcgaaacgcctgccgaagagcgtatcgcctatatccgccgcatagccgaa
atttacgaatcacggctcgacgagatggcaaaaaccatttcgatggaaatgggcgcacca
atcaagcttgcgcgcgaatcacaggccgcagccggcctgtcgcacaccaaggcattcatc
gccgcttgcgaaaattttgaggttgaggaagtcctctcccccaaatatccaaaccagacc
gccgtgcatgagccaatcggcgtttgcggcctcatcacgccatggaactggccaatgaac
cagatcacgctcaaggtgatcccggccattgctgtcggctacacggtggttttgaagcct
tccgaaatagcgccgatgtcggccatgctttttgccgaatttgtcgatcaggcgggcctg
ccgaaaggtgttttcaacctcgtcaatggcgaaggtccggtcgtgggcgaagccctttcg
cagcaccccgaagtggacatgatgtcgtttaccggctcgacacgcgccggaacggccgtt
tcgcgcgcggcagcagcaaccgtaaaacgcgtttcgctggagcttggcggcaaatcgccc
aatatcgtcttcgccgatagcgatctggaaaaggcaatttcccgcagcctcgcccattgc
tttgagaataccggccagtcctgcaacgcaccgacacgtatgctggtggaacgctcggtc
tatgataaggctgtggagcttgcaaaaaaaagcagcggaaagcaccaaggtcggcgatcc
ggcgcaggaaggggaccatatcggcccgctttcttcctctatccagttcgagaaggttca
ggcgctcatccagaagggcattga

DBGET integrated database retrieval system