KEGG   Brucella suis bv. 2 Bs143CITA: BSSP1_I0382Help
Entry
BSSP1_I0382       CDS       T03367                                 

Gene name
cobQ
Definition
(GenBank) Cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
bsui  Brucella suis bv. 2 Bs143CITA
Pathway
bsui00860  Porphyrin and chlorophyll metabolism
bsui01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsui00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSSP1_I0382 (cobQ)
Enzymes [BR:bsui01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     BSSP1_I0382 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 GATase_5 SNO
Motif
Other DBs
NCBI-ProteinID: AIB27251
Position
I:390326..391777
Genome map
AA seq 483 aa AA seqDB search
MARAIMFQGTGSDVGKSVLVAGLCRVARNRGLKVRPFKPQNMSNNAAVSDDGGEIGRAQW
LQALACGVPSSVHMNPVLLKPQTDMGSQLIVQGQVRGEARGRYYQELKPQLMAAVMESFA
KVGDGADLVLVEGAGSPAEINLRAGDIANMGFAIHADVPVVLVGDIDRGGVIASLVGTHT
ILPQEDRAMVRGFLINKFRGDISLFDDGLAAITRFTGWRSFGVVPWLKAVSRLPAEDSVV
LERAVRGDKKALIVAVPMLPRIANFDDLDPLKAEPAVEVVMVPPGSSLPADAGLVVLPGT
KSTIADLLALRENGWDRELVAHVKRGGHVLGICGGFQMLGRRISDPAGIEGNVRDIEGLG
LLDIETMMEPEKVVRNVEAVSLLHDEPLEGYEIHIGRTSGPDMARPFARIGDHDDGAVSP
DGRIMGTYLHGVFSADRFRHHFLRALGVEGGQMNYRESVEEALDELAEGLEASLDIDGLF
ALA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtgcgatcatgtttcagggaaccggctcggatgtcggcaagagtgttcttgtc
gccgggctttgccgcgttgcgcgcaatcgcggcctgaaggtgcgcccgttcaagccgcag
aatatgtcgaacaatgccgccgtcagtgatgatgggggcgagatcggtcgcgcgcaatgg
cttcaggcgcttgcctgcggcgtgccgtcttcggtgcatatgaacccggttctgctcaaa
ccccagacggatatgggcagtcagcttattgtgcaggggcaggtgcgcggtgaggcgcgc
gggcgttattatcaggaattgaagccgcagctcatggcggcggtgatggagtcttttgca
aaggttggtgacggcgccgatctggtgctggtggaaggcgcgggttctccggctgaaatc
aatcttcgcgcgggcgatatagccaatatgggctttgccatccatgcagatgttccggtc
gttctggttggtgatatcgaccggggcggggtgattgcctctctggttggcacgcacacg
attttgccgcaggaagaccgcgccatggtgcggggctttctcatcaacaagtttcgcggc
gatatttccctttttgatgatggtcttgcggcgatcacgcggtttaccggctggcgctct
ttcggtgtggtgccgtggctgaaggcggtgtcgcgtctgccagcggaggattccgtcgtt
ctggagcgcgcggtgcgcggggacaaaaaagcgctcatcgtggccgtgcccatgctgccg
cgcatcgccaattttgacgatctcgatcctttgaaggcggagcctgcggtggaggtggtg
atggtgccgccgggctccagcctgcctgcggatgcggggcttgtcgtgttgcccggcacc
aaatccacgattgccgatctgctggcgctgcgtgaaaacggctgggaccgcgaattggtc
gcccatgtgaagcggggcgggcatgtgcttggtatttgcggcgggtttcaaatgcttgga
cggcggatcagtgacccggcgggtattgaaggcaatgtgcgcgatatcgaggggctgggc
cttctcgatatcgagacgatgatggagccggaaaaagtggttcgcaatgttgaggcggtg
tcgctgctgcatgatgagccgctggagggctatgaaatccacatcgggcgcaccagcggg
ccggatatggcgcggccatttgcgcgtatcggcgatcatgatgatggggccgtctcgccc
gatggtcgtatcatgggaacctatctccacggtgttttcagtgcggatcgtttccgccac
cactttttgcgcgcgctgggtgtggaaggcggccagatgaattatcgcgagagcgtcgaa
gaggctctggacgaactggctgaagggctggaagcctcgctggatattgatggcctgttt
gcgctggcatga

DBGET integrated database retrieval system