KEGG   Brucella suis bv. 2 Bs143CITA: BSSP1_I0707Help
Entry
BSSP1_I0707       CDS       T03367                                 

Gene name
metG
Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bsui  Brucella suis bv. 2 Bs143CITA
Pathway
bsui00450  Selenocompound metabolism
bsui00970  Aminoacyl-tRNA biosynthesis
bsui01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsui00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BSSP1_I0707 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BSSP1_I0707 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsui01007]
    BSSP1_I0707 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsui03016]
    BSSP1_I0707 (metG)
Enzymes [BR:bsui01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BSSP1_I0707 (metG)
Amino acid related enzymes [BR:bsui01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BSSP1_I0707 (metG)
Transfer RNA biogenesis [BR:bsui03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BSSP1_I0707 (metG)
 Prokaryotic type
   Other AARSs
    BSSP1_I0707 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f DUF2529
Motif
Other DBs
NCBI-ProteinID: AIB27569
Structure
PDB: 

Position
I:complement(703550..705097)
Genome map
AA seq 515 aa AA seqDB search
MSREKYYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYFLTGTDEHGIKMLQS
ARKEGITPRELADRNTSAFRRMAEVLNSSNDDYIRTSEERHYKASQAIWQAMVANGDIYK
GGYAGWYSVRDEAYYGEEETEVRADGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLDLYE
NNPGFIMPAERRNEIVSFVKSGLKDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYITA
LGYPDTTDERWAYWPANAHIIGKDISRFHAVYWPAFLMSAQLPLPKRVFAHGFLFNRGEK
MSKSVGNVIDPFELVERYGLDQLRYFLMREVPFGQDGSYSHEAIVNRTNADLANDLGNLA
QRSLSMIAKNCEGKVPQPGAFSEADKAILDQADAALETARKAMDDQALHLALGAIFAVVA
EANRYFAGQEPWALRKTDPARMGTVLYVTAEVLRRVGIMVQPFIPQSAEKLLDILAVPAD
KRQFADVLASPLAGGTDLPAPQPVFPRYVEADEQN
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcgaaaaatattacatcacgactgcgattgcttatccgaacggaaagccgcat
atcggccacgcttacgaactgatcgcgaccgatgccatggcgcggtttcagcgtctcaat
ggcatggatgtttattttctgaccggcacggacgagcatggcatcaagatgctgcaaagc
gcgcgcaaggaaggcattacgccgcgcgagctggcagaccgcaacacatccgccttccgt
cgaatggctgaagtgctgaacagctccaacgacgactatatccgcacctccgaagagcgt
cattacaaggccagccaggccatttggcaggcgatggtcgcaaatggggatatttacaag
ggcggctatgccggctggtattccgtgcgcgacgaagcctattacggcgaggaagaaacg
gaagtgcgcgcggatggcgtccgctacggcccgcagggaacgcctgtggaatgggtggag
gaggaaagctatttcttccgtctttcggcctatcaggacaagctgctcgacctctacgag
aacaatccgggctttatcatgcccgccgaacgccgcaatgagattgtgagcttcgtgaag
tcaggtctcaaggacctgtcgatttcgcgcacgaccttcgattggggcattccggtgccg
ggagatgaaaagcacgtcatgtatgtgtgggtggatgcgctcaccaattacatcactgcg
ctcggctatcctgatacgaccgatgagcgttgggcttactggcccgccaatgcccatatc
atcggcaaggatatttcccgcttccatgcggtctattggcctgcattcctgatgtcggcc
caattacccttgccgaagcgtgttttcgcgcatgggttcctgttcaatcgcggcgagaaa
atgtcgaagtcagtcggcaatgttatcgatccgtttgaactggtggagcgttacggcctg
gaccagttgcgttatttcctgatgcgtgaagtgccattcggtcaggatggcagctacagc
catgaggcgatcgtcaaccgcaccaatgccgatctggccaacgacctcggcaatcttgcc
cagcgttcgctatcgatgatcgccaagaattgcgaaggcaaggtgccgcagcccggcgca
ttttccgaggctgacaaggccattctggatcaggccgatgccgcgctcgaaaccgcgcgc
aaggcaatggacgatcaggccctgcatctggcattgggtgcgatcttcgctgttgtggcg
gaagccaaccgctattttgcggggcaggagccatgggcactgcgcaagaccgatcctgcg
cgcatgggcaccgtgctctatgtaacagccgaggttctgcgccgcgtcggcatcatggtg
cagcctttcatcccgcaatctgcggagaagctgctcgatattctggctgtcccggctgac
aagcgccagtttgccgatgtgctggcaagcccgcttgctggtgggaccgatctgcctgcg
ccgcagccggtcttcccgcgctatgtggaagcagacgaacagaactga

DBGET integrated database retrieval system