KEGG   Brucella suis bv. 2 Bs143CITA: BSSP1_I1300Help
Entry
BSSP1_I1300       CDS       T03367                                 

Gene name
glyQ
Definition
(GenBank) Glycyl-tRNA synthetase alpha chain
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
bsui  Brucella suis bv. 2 Bs143CITA
Pathway
bsui00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bsui00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BSSP1_I1300 (glyQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsui01007]
    BSSP1_I1300 (glyQ)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsui03016]
    BSSP1_I1300 (glyQ)
Enzymes [BR:bsui01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     BSSP1_I1300 (glyQ)
Amino acid related enzymes [BR:bsui01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   BSSP1_I1300 (glyQ)
Transfer RNA biogenesis [BR:bsui03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BSSP1_I1300 (glyQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e N-glycanase_C DUF3707
Motif
Other DBs
NCBI-ProteinID: AIB28150
Position
I:complement(1256660..1257586)
Genome map
AA seq 308 aa AA seqDB search
MHPTRSFQGLILTLHNYWAEHGCAILQPYDMEVGAGTFHPATTLRSLGPKPWKAAYVQPS
RRPKDGRYGENPNRLQHYYQYQVLIKPSPPNLQDLYLGSLKAIGLDPTLHDVRFVEDDWE
SPTLGAWGLGWECWCDGMEVSQFTYFQQVCGIECSPVAGELTYGLERLAMYVQGVDNVYD
LNFNGLEGDEKVTYGDVFLQAEQEYSRYNFEMANTETLHQHFIDAERECEAILKAGSTGE
NSLHKCVFPAYDQCIKASHVFNLMDARGVISVTERQSYILRVRNLARQCGEAFLLTDAGG
FNFKREGE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcaccccacccgttcctttcagggtttgatcctgacgctccataattactgggcggaa
cacggttgcgccattctgcaaccttacgacatggaagtgggcgccggtacgttccatccg
gcgacgacgctgcgttcgctggggccaaagccctggaaggcggcctatgtgcagccgtcg
cgccgtccgaaagatggccgctatggcgaaaatccgaaccggctccagcattattatcag
tatcaggtgctcatcaagccgtcgccgccaaaccttcaggatctttatctgggttccctc
aaggccatcggcctcgacccgacgctgcatgacgtgcgctttgtggaagacgactgggaa
agcccgacgctgggcgcctgggggcttgggtgggaatgctggtgcgacggcatggaagtc
tcgcagttcacctatttccagcaggtctgcggcattgaatgttcgcctgttgccggtgaa
ctgacctatggtctggagcggcttgccatgtatgtgcagggcgtggacaatgtctatgac
ctgaatttcaatgggctcgaaggcgacgagaaagtcacctatggtgatgtgttcctgcaa
gccgagcaggaatattcccgctacaactttgaaatggccaacaccgagactttgcatcag
catttcattgatgccgagcgcgagtgcgaggccattttgaaagccggcagcacgggcgag
aactcactgcataaatgcgtgtttccggcctatgaccagtgcatcaaggcatcccatgtt
ttcaatctgatggatgcgcgcggcgtgatctccgttaccgagcgtcagagctacattctg
cgcgtgcgcaaccttgcgcgccagtgcggcgaggcattccttttgacggatgccggtggt
ttcaatttcaagcgtgagggcgagtga

DBGET integrated database retrieval system