KEGG   Brucella suis bv. 2 Bs143CITA: BSSP1_II0391Help
Entry
BSSP1_II0391      CDS       T03367                                 

Definition
(GenBank) Glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
bsui  Brucella suis bv. 2 Bs143CITA
Pathway
bsui00860  Porphyrin and chlorophyll metabolism
bsui01100  Metabolic pathways
bsui01110  Biosynthesis of secondary metabolites
bsui01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsui00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSSP1_II0391
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsui01007]
    BSSP1_II0391
Enzymes [BR:bsui01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     BSSP1_II0391
Amino acid related enzymes [BR:bsui01007]
 Aminotransferase (transaminase)
  Class III
   BSSP1_II0391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AIB29217
Position
II:392369..393730
Genome map
AA seq 453 aa AA seqDB search
MNLFTSQFRNSQLLASKAHALIPGGCHTYAKGDDQYPVLAPGFIQRGSGAHVFDVDGHEY
IEYGMGNRAVGLGHAYPPVVRAVREALQDGCNFTRPSAIELDCAESFLELIEGAEMVKFC
KDGSDATSGALRLARAYTGRDMVACCADHPFFSTDDWFIGTTKMSAGIPASVSALTATFR
YNDIASVEALFEDYPGRIAAIIMEPARAGEPQDNFLHEAMRIAHENGALFILDEMITGFR
WHMRGAQKLYGIVPDLSCFGKALGNGFAISALAGKAEYMRLGGLHHTDFPRVFLLSTTHG
AETHAMAAAIATMAIYRDEPVIERLYEQGAKLAAGINEAIAGHRLQDHVRLSGRPCCLTY
STLDGNGMPSQAFRILFLQETIRRGVLMPSLVVSYTHSDADIARTIDAVHGALGIYVRAL
NDGVESCLVGRPSQVVYRRFNEDPASSCPPPRL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttttcacatcgcagtttcgcaattcgcaattgctggccagcaaggcccatgcg
ctcattcccggcgggtgccatacctatgccaagggagacgatcagtatccggtgcttgcg
ccgggtttcatccagcgcggctcaggcgcccatgtcttcgacgtggatggccacgaatat
atcgaatatgggatgggaaaccgcgccgtcggcctcggccatgcctatccgccggtggtg
cgagccgtacgcgaggccttgcaggatggctgcaattttacccggccaagtgctatcgaa
ctcgactgcgcggaaagctttctcgaactgattgagggggcggaaatggtcaaattctgc
aaggacggctcggatgcgacttccggcgcgcttcgccttgcccgcgcctatacagggcgt
gacatggtggcctgctgcgccgaccatcccttcttttcgaccgacgactggttcattggc
accacgaagatgagcgcaggcattcccgcgtcggtttctgcgctcaccgcgacgtttcgc
tataatgatattgccagtgtcgaggcgcttttcgaggactatccggggcgcatcgccgcc
atcatcatggagccggcgcgcgcaggggagccgcaagacaattttctccatgaagccatg
cgcattgcccatgaaaacggtgcacttttcattctggatgaaatgattaccggctttcgc
tggcatatgcgcggcgcgcagaagctttatggtatcgtgccggacctttcctgtttcgga
aaggcgctcggcaatggctttgccatttctgcgctcgcgggcaaggccgaatatatgcgg
cttggcgggcttcaccatacggatttcccccgcgtctttctgctttccacgacgcatggg
gcggaaacccatgccatggccgcggcgattgccactatggcgatctatcgcgatgagccg
gtgatcgagcgtctttatgaacaaggtgcgaagcttgccgcaggcataaacgaggctatt
gccggtcatcggcttcaggatcatgtgcgcctatcggggcggccttgttgcctcacctat
tccacgctggatggaaacggaatgccttcgcaggcatttcgcatccttttccttcaggaa
acaatccggcgcggcgtgctgatgccctcgctggttgtgagctacacgcatagcgatgcc
gatattgcccgcaccatcgatgcggttcacggtgcgctcggcatctatgtgcgggcgctc
aatgacggcgtggagtcctgtctggtcgggcggccgtcgcaggttgtctatcgccgtttc
aacgaagatccggcttcctcatgcccaccgccaagattgtaa

DBGET integrated database retrieval system