KEGG   Brucella suis bv. 2 Bs143CITA: BSSP1_II1212Help
Entry
BSSP1_II1212      CDS       T03367                                 

Gene name
phbA-1
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bsui  Brucella suis bv. 2 Bs143CITA
Pathway
bsui00071  Fatty acid degradation
bsui00072  Synthesis and degradation of ketone bodies
bsui00280  Valine, leucine and isoleucine degradation
bsui00310  Lysine degradation
bsui00362  Benzoate degradation
bsui00380  Tryptophan metabolism
bsui00620  Pyruvate metabolism
bsui00630  Glyoxylate and dicarboxylate metabolism
bsui00640  Propanoate metabolism
bsui00650  Butanoate metabolism
bsui00900  Terpenoid backbone biosynthesis
bsui01100  Metabolic pathways
bsui01110  Biosynthesis of secondary metabolites
bsui01120  Microbial metabolism in diverse environments
bsui01130  Biosynthesis of antibiotics
bsui01200  Carbon metabolism
bsui01212  Fatty acid metabolism
bsui02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsui00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSSP1_II1212 (phbA-1)
   00630 Glyoxylate and dicarboxylate metabolism
    BSSP1_II1212 (phbA-1)
   00640 Propanoate metabolism
    BSSP1_II1212 (phbA-1)
   00650 Butanoate metabolism
    BSSP1_II1212 (phbA-1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSSP1_II1212 (phbA-1)
   00072 Synthesis and degradation of ketone bodies
    BSSP1_II1212 (phbA-1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSSP1_II1212 (phbA-1)
   00310 Lysine degradation
    BSSP1_II1212 (phbA-1)
   00380 Tryptophan metabolism
    BSSP1_II1212 (phbA-1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSSP1_II1212 (phbA-1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSSP1_II1212 (phbA-1)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSSP1_II1212 (phbA-1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsui04147]
    BSSP1_II1212 (phbA-1)
Enzymes [BR:bsui01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BSSP1_II1212 (phbA-1)
Exosome [BR:bsui04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSSP1_II1212 (phbA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIB30022
Position
II:complement(1181049..1182233)
Genome map
AA seq 394 aa AA seqDB search
MSDPKSIVIASAARTAVGAFNGAFANVPAHELGAVAIKAALERAGVDAADVDEVILGQVL
TAGEGQNPARQAAMGAGCPKETTAFAINQLCGSGLRAVALGMQQIVSGDAKIIVAGGQES
MSMAPHCAYLRSGVKMGDFKMIDTMLKDGLTDAFHGYHMGITAENIARQWQLSRSEQDEF
ALASQHKAEAAQKAGRFDEEIVPFTVKARKGDVVVSADEYIRPGTTMEVLAKLKPAFDKE
GTVTAGNASGINDGAAAVVLMDAGEAARRGVKPLARIVSWATAGVDPSIMGTGPIPATRK
ALEKAGWSVGDLDLVEANEAFAAQSCAVVRDLGLNPEIVNVNGGAIAIGHPIGASGARVL
TTLLYEMERRDAKRGLATLCIGGGMGVALCVERD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatccgaaatccatcgtcatcgccagtgcagcgcgcaccgcggtgggtgccttt
aatggcgcctttgccaatgttcctgctcatgaactgggtgcagtggccatcaaggctgct
ctggagcgtgctggtgtcgatgcggcggatgtcgatgaggttattctggggcaggtgctg
acggcaggcgaagggcagaatcccgcccgtcaggccgccatgggggccggttgcccgaag
gaaaccaccgcttttgccatcaaccagctctgcggttccggcctgcgggcggttgcgctc
gggatgcagcagattgtttccggcgatgcgaagattatcgtggcgggcgggcaggaatcc
atgtccatggcgccgcattgtgcctatctgcgctccggcgtgaagatgggcgatttcaag
atgatcgacaccatgctgaaagacggcctgaccgatgctttccatggctatcacatgggc
atcaccgctgaaaatattgcgcgccaatggcagttgagccgcagcgagcaggacgagttc
gcactcgcctcgcagcacaaagccgaggccgcgcagaaggcaggccgcttcgatgaggag
atcgtgcctttcaccgtcaaggcccgcaagggggatgttgtggtttcggcagatgaatat
atccgtccgggcacgacgatggaggtgctggccaagctgaagccggcttttgacaaggaa
ggcacggtgacggcgggcaatgcatccggcatcaatgacggtgccgcagcggttgtgctg
atggatgctggcgaggcagccaggcgtggcgtgaagcctctggcgcgcatcgtatcctgg
gcgacggctggcgttgatccgtcgatcatgggaaccgggccgattcccgcaacgcggaag
gcgctggaaaaggcaggctggagcgttggcgaccttgatcttgttgaggccaatgaggcc
tttgcagcgcagtcatgcgcggtggtgcgcgatctgggtctcaatcctgaaatcgtcaat
gtcaatggcggcgcaatcgccatcggccatccgatcggcgcctccggcgcccgcgtgctg
acgacgctgctctacgaaatggagcgtcgcgatgccaagcgtggtctggcgacgctttgt
atcggcggcggcatgggcgtggccctttgtgtcgagcgggattga

DBGET integrated database retrieval system