KEGG   Bacillus subtilis subsp. subtilis JH642: BSUA_00370Help
Entry
BSUA_00370        CDS       T03443                                 

Gene name
putC
Definition
(GenBank) 1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
bsul  Bacillus subtilis subsp. subtilis JH642
Pathway
bsul00250  Alanine, aspartate and glutamate metabolism
bsul00330  Arginine and proline metabolism
bsul01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsul00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSUA_00370 (putC)
   00330 Arginine and proline metabolism
    BSUA_00370 (putC)
Enzymes [BR:bsul01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     BSUA_00370 (putC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF4129 DUF1489
Motif
Other DBs
NCBI-ProteinID: AIC38697
Position
345487..347034
Genome map
AA seq 515 aa AA seqDB search
MTTPYKHEPFTNFQDQNNVEAFKKALATVSEYLGKDYPLVINGERVETEAKIVSINPADK
EEVVGRVSKASQEHAEQAIQAAAKAFEEWRYTSPEERAAVLFRAAAKVRRRKHEFSALLV
KEAGKPWNEADADTAEAIDFMEYYARQMIELAKGKPVNSREGEKNQYVYTPTGVTVVIPP
WNFLFAIMAGTTVAPIVTGNTVVLKPASATPVIAAKFVEVLEESGLPKGVVNFVPGSGAE
VGDYLVDHPKTSLITFTGSREVGTRIFERAAKVQPGQQHLKRVIAEMGGKDTVVVDEDAD
IELAAQSIFTSAFGFAGQKCSAGSRAVVHEKVYDQVLERVIEITESKVTAKPDSADVYMG
PVIDQGSYDKIMSYIEIGKQEGRLVSGGTGDDSKGYFIKPTIFADLDPKARLMQEEIFGP
VVAFCKVSDFDEALEVANNTEYGLTGAVITNNRKHIERAKQEFHVGNLYFNRNCTGAIVG
YHPFGGFKMSGTDSKAGGPDYLALHMQAKTISEMF
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaccttacaaacacgagccattcacaaatttccaagatcaaaacaacgtggaa
gcgtttaaaaaagcgcttgcgacagtaagcgaatatttaggaaaagactatccgcttgtc
attaacggcgagagagtggaaacggaagcgaaaatcgtttcaatcaacccagctgataaa
gaagaagtcgtcggccgagtgtcaaaagcgtctcaagagcacgctgagcaagcgattcaa
gcggctgcaaaagcatttgaagagtggagatacacgtctcctgaagagagagcggctgtc
ctgttccgcgctgctgccaaagtccgcagaagaaaacatgaattctcagctttgcttgtg
aaagaagcaggaaagccttggaacgaggcggatgccgatacggctgaagcgattgacttc
atggagtattatgcacgccaaatgatcgaactggcaaaaggcaaaccggtcaacagccgt
gaaggcgagaaaaaccaatatgtatacacgccgactggagtgacagtcgttatcccgcct
tggaacttcttgtttgcgatcatggcaggcacaacagtggcgccgatcgttactggaaac
acagtggttctgaaacctgcgagtgctacacctgttattgcagcaaaatttgttgaggtg
cttgaagagtccggattgccaaaaggcgtagtcaactttgttccgggaagcggagcggaa
gtaggcgactatcttgttgaccatccgaaaacaagccttatcacatttacgggatcaaga
gaagttggtacgagaattttcgaacgcgcggcgaaggttcagccgggccagcagcattta
aagcgtgtcatcgctgaaatgggcggtaaagatacggttgttgttgatgaggatgcggac
attgaattagcggctcaatcgatctttacttcagcattcggctttgcgggacaaaaatgc
tctgcaggttcacgtgcagtagttcatgaaaaagtgtatgatcaagtattagagcgtgtc
attgaaattacggaatcaaaagtaacagctaaacctgacagtgcagatgtttatatggga
cctgtcattgaccaaggttcttatgataaaattatgagctatattgagatcggaaaacag
gaagggcgtttagtaagcggcggtactggtgatgattcgaaaggatacttcatcaaaccg
acgatcttcgctgaccttgatccgaaagcaagactcatgcaggaagaaattttcggacct
gtcgttgcattttgtaaagtgtcagactttgatgaagctttagaagtggcaaacaatact
gaatatggtttgacaggcgcggttatcacaaacaaccgcaagcacatcgagcgtgcgaaa
caggaattccatgtcggaaacctatacttcaaccgcaactgtacaggtgctatcgtcggc
taccatccgtttggcggcttcaaaatgtcgggaacggattcaaaagcaggcgggccggat
tacttggctctgcatatgcaagcaaaaacaatcagtgaaatgttctaa

DBGET integrated database retrieval system