KEGG   Bacillus subtilis subsp. subtilis JH642: BSUA_01132Help
Entry
BSUA_01132        CDS       T03443                                 

Gene name
yhfS
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bsul  Bacillus subtilis subsp. subtilis JH642
Pathway
bsul00071  Fatty acid degradation
bsul00072  Synthesis and degradation of ketone bodies
bsul00280  Valine, leucine and isoleucine degradation
bsul00310  Lysine degradation
bsul00362  Benzoate degradation
bsul00380  Tryptophan metabolism
bsul00620  Pyruvate metabolism
bsul00630  Glyoxylate and dicarboxylate metabolism
bsul00640  Propanoate metabolism
bsul00650  Butanoate metabolism
bsul00900  Terpenoid backbone biosynthesis
bsul01100  Metabolic pathways
bsul01110  Biosynthesis of secondary metabolites
bsul01120  Microbial metabolism in diverse environments
bsul01130  Biosynthesis of antibiotics
bsul01200  Carbon metabolism
bsul01212  Fatty acid metabolism
bsul02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSUA_01132 (yhfS)
   00630 Glyoxylate and dicarboxylate metabolism
    BSUA_01132 (yhfS)
   00640 Propanoate metabolism
    BSUA_01132 (yhfS)
   00650 Butanoate metabolism
    BSUA_01132 (yhfS)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSUA_01132 (yhfS)
   00072 Synthesis and degradation of ketone bodies
    BSUA_01132 (yhfS)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSUA_01132 (yhfS)
   00310 Lysine degradation
    BSUA_01132 (yhfS)
   00380 Tryptophan metabolism
    BSUA_01132 (yhfS)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSUA_01132 (yhfS)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSUA_01132 (yhfS)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSUA_01132 (yhfS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsul04147]
    BSUA_01132 (yhfS)
Enzymes [BR:bsul01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BSUA_01132 (yhfS)
Exosome [BR:bsul04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSUA_01132 (yhfS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIC39421
Position
complement(1092936..1094030)
Genome map
AA seq 364 aa AA seqDB search
MNAVIVDAKRTIFGNQNGLLKPFLPEDLAAPIIRCLSRKLEDQVDEVILGNATGRGGNLA
RLSALQAGLPLSVPGMTIDRQCGSGLEAVRYACSLIQAGAGTMYIAGGSESSSQSPFSER
ARFSPDAIGDPDMGIAAEYTAARYSISRSMQDEYALLSHQRSRNAHDEGFYREEVVALGE
LETDEAFLKTRPIEAIIPRAKPVFDTSSGTVTAANSSGIADGAAALLVMEEEKAAALGLK
PVLRFIGSAVSGIHPNFPPAAPVVAIRQLLHTHDVTPDDIDLFEINEAFAVKICVCSQEL
GIPFSKINVRGGALALGHPYGASGAALVTRLFYEAKRRPDCQYAVAAIGSGGGIGLALLF
EVLA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcggttattgttgatgcaaaacgaacgatctttggaaatcaaaacggactgctg
aagcccttcctgccggaggatttggcggctcccatcatccgctgtctcagccgaaagcta
gaggatcaagttgacgaggtcattctcggaaacgctactggcagaggcggcaacctggcc
agactgtcagcccttcaagccggactgcctttatcggttcccggaatgacaattgacaga
cagtgcggctccggccttgaagctgtgcgctatgcctgcagccttattcaagcgggagcc
ggcacgatgtatatcgcgggcggctcagaaagcagcagccaatcccctttttcagaacgg
gctcgcttttctccagatgcgatcggcgatccagacatgggcattgcggcagaatatacg
gctgcacgctattccatcagcagaagcatgcaggatgagtacgcgcttctcagccatcaa
cgcagcaggaacgcgcatgatgaaggattttaccgtgaagaagttgttgctctcggggaa
ttggagacggacgaagcatttttgaaaacgcggccaatagaagcgattattccccgtgca
aagccggttttcgacaccagctccggaacagtcacagcagccaacagcagtggcatagca
gacggagcagccgctcttttggtaatggaagaagaaaaagcagcagccctgggacttaag
cctgtgcttcggtttatcggcagcgctgtcagcggcattcaccccaactttccgcccgcg
gcaccggttgtcgcgattcgtcagctcttacatacacacgatgtaacacctgatgatatc
gatttatttgaaatcaatgaagcctttgccgtcaaaatttgtgtctgctcgcaagaactc
ggcattcccttttcaaaaatcaatgtgcgcggcggcgccttagctcttggccatccgtac
ggtgcatcaggtgcagctctggtaaccagattgttttatgaagcgaaaagacggccagac
tgtcaatatgctgttgcagccatcggaagcggcggcggaatcggactggctttattattt
gaagttcttgcatag

DBGET integrated database retrieval system