KEGG   Bacillus subtilis subsp. subtilis JH642: BSUA_02555Help
Entry
BSUA_02555        CDS       T03443                                 

Gene name
yqjM
Definition
(GenBank) NADPH dehydrogenase NamA
  KO
K00354  NADPH2 dehydrogenase [EC:1.6.99.1]
Organism
bsul  Bacillus subtilis subsp. subtilis JH642
Brite
KEGG Orthology (KO) [BR:bsul00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSUA_02555 (yqjM)
Enzymes [BR:bsul01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.1  NADPH dehydrogenase
     BSUA_02555 (yqjM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_FMN Dus AP_endonuc_2 G3P_antiterm
Motif
Other DBs
NCBI-ProteinID: AIC40834
Structure
PDB: 

Position
2448611..2449627
Genome map
AA seq 338 aa AA seqDB search
MARKLFTPITIKDMTLKNRIVMSPMCMYSSHEKDGKLTPFHMAHYISRAIGQVGLIIVEA
SAVNPQGRITDQDLGIWSDEHIEGFAKLTEQVKEQGSKIGIQLAHAGRKAELEGDIFAPS
AIAFDEQSATPVEMSAEKVKETVQEFKQAAARAKEAGFDVIEIHAAHGYLIHEFLSPLSN
HRTDEYGGSPENRYRFLREIIDEVKQVWDGPLFVRVSASDYTDKGLDIADHIGFAKWMKE
QGVDLIDCSSGALVHADINVFPGYQVSFAEKIREQADMATGAVGMITDGSMAEEILQNGR
ADLIFIGRELLRDPFFARTAAKQLNTEIPAPVQYERGW
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggccagaaaattatttacacctattacaattaaagatatgacgttaaaaaaccgcatt
gtcatgtcgccaatgtgcatgtattcttctcatgaaaaggacggaaaattaacaccgttc
cacatggcacattacatatcgcgcgcaatcggccaggtcggactgattattgtagaggcg
tcagcggttaaccctcaaggacgaatcactgaccaagacttaggcatttggagcgacgag
catattgaaggctttgcaaaactgactgagcaggtcaaagaacaaggttcaaaaatcggc
attcagcttgcccatgccggacgtaaagctgagcttgaaggagatatcttcgctccatcg
gcgattgcgtttgacgaacaatcagcaacacctgtagaaatgtcagcagaaaaagtaaaa
gaaacggtccaggagttcaagcaagcggctgcccgcgcaaaagaagccggctttgatgtg
attgaaattcatgcggcgcacggatatttaattcatgaatttttgtctccgctttccaac
catcgaacagatgaatatggcggctcacctgaaaaccgctatcgtttcttgagagagatc
attgatgaagtcaaacaagtatgggacggtcctttatttgtccgtgtatctgcttctgac
tacactgataaaggcttagacattgccgatcacatcggttttgcaaaatggatgaaggag
cagggtgttgacttaattgactgcagctcaggcgcccttgttcacgcagacattaacgta
ttccctggctatcaggtcagcttcgctgagaaaatccgtgaacaggcggacatggctact
ggtgccgtcggcatgattacagacggttcaatggctgaagaaattctgcaaaacggacgt
gccgacctcatctttatcggcagagagcttttgcgggatccattttttgcaagaactgct
gcgaaacagctcaatacagagattccggcccctgttcaatacgaaagaggctggtaa

DBGET integrated database retrieval system