KEGG   Bacillus subtilis subsp. subtilis JH642: BSUA_02932Help
Entry
BSUA_02932        CDS       T03443                                 

Gene name
yrrC
Definition
(GenBank) exonuclease with DNA/RNA helicase motif
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bsul  Bacillus subtilis subsp. subtilis JH642
Pathway
bsul03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bsul00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    BSUA_02932 (yrrC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsul03400]
    BSUA_02932 (yrrC)
Enzymes [BR:bsul01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BSUA_02932 (yrrC)
DNA repair and recombination proteins [BR:bsul03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BSUA_02932 (yrrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 SH3_13 UvrD_C_2 Viral_helicase1 AAA_11 HHH_5 UvrD_C AAA_12 AAA_22 T2SSE UvrD-helicase AAA_16 AAA_18 AAA TsaE NTPase_1 Rad17 Zeta_toxin AAA_28 AAA_17
Motif
Other DBs
NCBI-ProteinID: AIC41208
Position
complement(2779052..2781448)
Genome map
AA seq 798 aa AA seqDB search
MQQHPDQLKLEEEPYLKGTVNTVIYHNDTNLYTVLKVKVTETSEAIEDKAVSVTGYFPAL
QEEETYTFYGKIVTHPKFGLQFQAEHFKKEIPTTKEGIIQYLSSDLFEGIGKKTAEEIVK
KLGDSAINKILADASVLYDVPRLSKKKADTLAGALQRHQGLEQIMISLNQFGFGPQLSMK
IYQAYESETLEKIQENPYQLVKDVEGIGFGKADELGSRMGLSGNHPERVKAAILYTLETT
CLSEGHTYIETEQLIIDTQSLLNQSAREGQRITEMDAANAIIALGENKDIVIEDGRCYFP
SLFYAEQNVAKRVKHIASQTEYENQFPESEFLLALGELEERMDVQYAPSQKEAIQKALSS
PMLLLTGGPGTGKTTVIRGIVELYGELHGVSLDPSAYKKDEAFPIVLAAPTGRAAKRMSE
STGLPAVTIHRLLGWNGAEGFTHTEDQPIEGKLLIIDEASMLDIWLANHLFKAIPDHIQI
IIVGDEDQLPSVGPGQVLRDLLASQVIPTVRLTDIYRQAEGSSIVELAHQMKNGLLPNNL
TAPTKDRSFIRCGGSQIKEVVEKVVANALKKGYTAKDIQVLAPMYRGKAGINELNVMLQD
ILNPPKEKRRELKFGDVVYRTGDKILQLVNQPENNVFNGDIGEITSIFYAKENTEKEDMA
VVSFDGNEMTFTKKDFNQFTHAYCCSIHKSQGSEFPIVVLPVVKGYYRMLRRNLLYTAIT
RAKKFLILCGEEEALEWGVKNNDATVRQTSLKNRLSVQVEEMDAELEALQKELPFSVHDA
NIGMEGITPFDFMKEEQQ
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcagcatccggatcagcttaaactggaggaagagccctatttaaaagggacagtc
aacacagtcatctatcataatgacaccaatttatatacggttctgaaagtgaaagtcaca
gagacctccgaagccattgaagataaagccgtatccgtgacgggctacttccctgcgctt
caagaagaagagacctacacgttttacggaaagatcgtaacccatccaaaattcgggctc
caatttcaggcggagcatttcaaaaaggagattccaacgactaaggaaggcatcattcaa
tatttatcgagtgatttattcgaggggatcggcaaaaaaacagctgaagaaattgtgaaa
aagctgggcgacagcgccattaataaaatattggctgatgcttcagtgctttatgatgtt
cccagactctcaaaaaagaaagcagacacgctggctggcgcattgcagcggcatcaggga
ctggagcaaatcatgatttccttgaatcagtttggctttggcccgcagctgtctatgaaa
atctatcaagcctatgaatccgagacgcttgaaaagattcaggaaaatccttatcagctt
gtgaaggatgtagaaggcatcgggtttggaaaagcggatgagctgggcagcagaatgggt
ctttcgggtaatcatcctgagcgggtaaaagctgctattttgtacacgcttgaaacgact
tgtctgtcagaggggcacacgtacatagaaacggaacagctgatcatcgacactcaatca
ctgttaaaccagtcagcaagggaagggcagcgcattacagaaatggatgccgctaacgca
attattgcccttggagaaaataaagacattgtcatagaagatggccgctgttattttcct
tcgctgttttacgcagaacaaaacgttgcaaagcgtgtgaaacatatcgctagccaaacc
gaatatgagaaccagtttcccgaatcagagtttttgctcgcgttgggagaactggaagaa
cggatggacgttcagtatgcccccagccagaaggaagcgattcaaaaagccctttcctcg
ccgatgcttcttttaacaggcggcccgggaacaggaaaaacgacggtaatcagagggatt
gtcgagctctacggagagcttcacggtgtgtcactagacccgtcagcttataaaaaggat
gaagcttttccgattgttttggccgctccgacagggagagcagcaaaacggatgagtgaa
tcaacgggactccctgcagttacgatacacaggctgcttggctggaacggcgctgaaggc
tttactcatacagaggatcagccgatcgaagggaagctgttaattatcgatgaagccagt
atgcttgatatatggctggcgaatcatttgttcaaggcgatccctgatcatatacaaatc
atcattgtcggagacgaagaccagctgccttccgtcggtccgggacaagtgctcagagac
ctgctggcatcccaggtgattccgactgtgagactgacagacatctatcgccaggcagaa
gggtcatcaatcgtcgagcttgcccaccagatgaaaaatggattgctgccgaacaatttg
actgccccgacaaaggaccgttcctttattcgctgcggcgggtcgcaaatcaaagaagta
gttgagaaggttgtcgccaatgcattgaaaaaaggctatacagcaaaggacattcaggtc
ctcgctccgatgtacagaggaaaagccggcattaatgaattgaatgtgatgctgcaggac
attttaaatcctcctaaagaaaaacggagagaattgaagttcggggatgttgtctacaga
accggagataaaattttgcagcttgtcaatcagccggaaaacaatgtgttcaacggagat
attggcgaaatcacgtcgatattttatgcaaaggaaaatacagaaaaagaagacatggcc
gtcgtttcttttgacggcaatgaaatgacatttacgaaaaaagattttaatcaatttacc
catgcgtattgctgttctattcataaatcgcagggaagtgaatttccgattgtggttttg
cctgttgtgaaaggctattatagaatgctcagaagaaaccttctttataccgcgattaca
agagcgaagaaatttctcattttatgcggggaagaggaggcgctggagtggggcgtgaaa
aataatgatgcaactgtcagacagacctccttgaaaaacaggctgtccgtacaggttgag
gaaatggatgccgagcttgaagctttgcaaaaagagctcccgttcagcgtacacgacgcc
aacattggcatggaaggcattacaccattcgattttatgaaagaagaacagcaataa

DBGET integrated database retrieval system