KEGG   Bacillus subtilis subsp. subtilis JH642: BSUA_02999Help
Entry
BSUA_02999        CDS       T03443                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
bsul  Bacillus subtilis subsp. subtilis JH642
Pathway
bsul00860  Porphyrin and chlorophyll metabolism
bsul01100  Metabolic pathways
bsul01110  Biosynthesis of secondary metabolites
bsul01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsul00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSUA_02999 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsul01007]
    BSUA_02999 (hemL)
Enzymes [BR:bsul01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     BSUA_02999 (hemL)
Amino acid related enzymes [BR:bsul01007]
 Aminotransferase (transaminase)
  Class III
   BSUA_02999 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AIC41275
Structure
PDB: 

Position
complement(2845646..2846938)
Genome map
AA seq 430 aa AA seqDB search
MRSYEKSKTAFKEAQKLMPGGVNSPVRAFKSVDMDPIFMERGKGSKIFDIDGNEYIDYVL
SWGPLILGHTNDRVVESLKKVAEYGTSFGAPTEVENELAKLVIDRVPSVEIVRMVSSGTE
ATMSALRLARGYTGRNKILKFEGCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGIAKNTI
TVPYNDLESVKLAFQQFGEDIAGVIVEPVAGNMGVVPPQEGFLQGLRDITEQYGSLLIFD
EVMTGFRVDYNCAQGYFGVTPDLTCLGKVIGGGLPVGAYGGKAEIMEQIAPSGPIYQAGT
LSGNPLAMTAGLETLKQLTPESYKNFIKKGDRLEEGISKTAGAHGIPHTFNRAGSMIGFF
FTNEPVINYETAKSSDLKLFASYYKGMANEGVFLPPSQFEGLFLSTAHTDEDIENTIQAA
EKVFAEISRR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagaagctatgaaaaatcaaaaacggcttttaaagaagcgcaaaaactcatgccgggc
ggtgtgaacagtcccgttcgcgcatttaaatcggtagacatggacccgatttttatggag
cgcggaaaaggctcgaaaatctttgatattgacgggaatgaatatattgactacgtcttg
tcatgggggcctttaattttagggcatacaaatgaccgcgtcgtagaaagcctcaaaaaa
gtggctgaatacgggacaagctttggtgctccgactgaagtagaaaatgaactggctaag
ctcgtcattgatcgtgtgccatctgtagaaattgtacgaatggtaagctccggaacagag
gctacaatgagtgccctccgtttggcaaggggctatacgggccgcaacaagattttaaaa
tttgagggctgctaccacggacacggcgattctctcttgattaaagctggttcaggtgtt
gccactctcggtctgcctgacagcccgggggtgcctgaaggcattgcgaaaaacaccatc
accgttccgtacaatgatttagaaagtgtaaagcttgctttccagcaattcggtgaagac
attgcgggagtcattgtagagccagttgccggaaatatgggtgttgttccgccgcaagaa
ggtttccttcagggtctgcgtgatatcactgagcagtacggctccctgctgatttttgat
gaagtgatgactggcttccgggtcgattataactgcgctcaaggctacttcggcgtaacg
cctgatctgacttgtttaggaaaagtaatcgggggcggacttcctgtcggcgcttatggc
ggaaaggcagaaatcatggagcagatcgctccaagcggtccgatctatcaagctggtaca
ttgtcaggcaacccgcttgcgatgacggctggcttagagacattgaaacagctgacacct
gaatcctacaagaatttcatcaaaaaaggcgacagactggaagaaggaatttcaaaaacc
gccggggctcatggcattccgcatacctttaaccgtgcaggttcgatgatcggtttcttc
tttacaaacgaaccagtcatcaattatgaaacagcgaaatcatctgatttgaagctgttc
gcaagctattataaagggatggcaaatgaaggggtattccttccgccatcacaattcgaa
ggtcttttcctctcaacggcccatactgatgaagatattgaaaacacaatccaggcagct
gagaaagtatttgctgagatcagccgcagataa

DBGET integrated database retrieval system