KEGG   Bacillus subtilis subsp. subtilis JH642: BSUA_03137Help
Entry
BSUA_03137        CDS       T03443                                 

Gene name
ackA
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
bsul  Bacillus subtilis subsp. subtilis JH642
Pathway
bsul00430  Taurine and hypotaurine metabolism
bsul00620  Pyruvate metabolism
bsul00640  Propanoate metabolism
bsul00680  Methane metabolism
bsul01100  Metabolic pathways
bsul01120  Microbial metabolism in diverse environments
bsul01200  Carbon metabolism
Module
bsul_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:bsul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSUA_03137 (ackA)
   00640 Propanoate metabolism
    BSUA_03137 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    BSUA_03137 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BSUA_03137 (ackA)
Enzymes [BR:bsul01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     BSUA_03137 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AIC41412
Position
complement(2987877..2989064)
Genome map
AA seq 395 aa AA seqDB search
MSKIIAINAGSSSLKFQLFEMPSETVLTKGLVERIGIADSVFTISVNGEKNTEVTDIPDH
AVAVKMLLNKLTEFGIIKDLNEIDGIGHRVVHGGEKFSDSVLLTDETIKEIEDISELAPL
HNPANIVGIKAFKEVLPNVPAVAVFDTAFHQTMPEQSYLYSLPYEYYEKFGIRKYGFHGT
SHKYVTERAAELLGRPLKDLRLISCHLGNGASIAAVEGGKSIDTSMGFTPLAGVAMGTRS
GNIDPALIPYIMEKTGQTADEVLNTLNKKSGLLGISGFSSDLRDIVEATKEGNERAETAL
EVFASRIHKYIGSYAARMSGVDAIIFTAGIGENSVEVRERVLRGLEFMGVYWDPALNNVR
GEEAFISYPHSPVKVMIIPTDEEVMIARDVVRLAK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaattattgcaattaacgcaggaagctcgtctttgaaatttcagcttttcgaa
atgccttcagaaaccgttttaacgaagggtttagttgaacgaatcggtatcgccgacagc
gtattcacaatttctgtgaacggcgaaaaaaatacagaagtaactgatattccagatcat
gcggtagctgttaaaatgctgctgaataagttaacggaattcggcattattaaagacttg
aatgaaattgacggaattggccatcgtgtcgttcacggcggagaaaaattcagcgattct
gttttattaacggatgaaaccattaaggaaatcgaagatatttctgaattggcaccgctt
cacaatccggcaaatatcgttggaattaaagcgttcaaagaagtgcttccaaatgttcct
gcggtagctgtatttgatacagcattccaccaaacaatgcctgagcagtcttacctttac
agcttgccgtatgaatactatgaaaaattcggcatccgtaaatacggcttccacggcact
tcacataaatatgtaactgagcgtgcggcagagcttctcggccgtccgttaaaagacttg
cgcctgatttcctgccaccttggaaacggagcaagtattgccgctgttgaaggcggaaaa
tctattgacacatccatgggctttacgccgcttgccggtgtagcaatgggcacacgctct
ggaaacatcgaccctgccctgatcccatacatcatggagaaaacaggccaaacggctgac
gaagtactgaatacattaaacaaaaaaagcggactgctcggcatttccggtttctcaagc
gatcttcgtgacatcgttgaagctacgaaagaaggaaatgagcgcgcggaaacggctctt
gaagtattcgcaagcagaatccacaaatacatcggttcttacgctgcaagaatgagcggt
gtagatgcgatcatctttactgccggtatcggtgaaaacagtgtggaagtcagagaacgc
gttcttcgcggtttagaattcatgggcgtatactgggaccctgcgcttaataacgtgcgc
ggcgaggaagctttcatcagctatccgcattctccagtaaaagtcatgatcatcccgact
gatgaagaagtcatgattgcgcgcgacgttgttcgtttagcaaaataa

DBGET integrated database retrieval system