KEGG   Bacillus subtilis subsp. subtilis JH642: BSUA_04141Help
Entry
BSUA_04141        CDS       T03443                                 

Gene name
yxjB
Definition
(GenBank) ribosomal RNA methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
bsul  Bacillus subtilis subsp. subtilis JH642
Brite
KEGG Orthology (KO) [BR:bsul00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsul03009]
    BSUA_04141 (yxjB)
Enzymes [BR:bsul01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     BSUA_04141 (yxjB)
Ribosome biogenesis [BR:bsul03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BSUA_04141 (yxjB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 MetW Methyltransf_23 Methyltransf_12
Motif
Other DBs
NCBI-ProteinID: AIC42386
Position
complement(3977050..3977820)
Genome map
AA seq 256 aa AA seqDB search
MICTERGHTFDLSRHGYVNFLTKPVKTSYGAELFEARSRLIGECGFFDPLHDAIAELISH
PKSGHEAFTILDSGCGEGSHLNALCGFDYAGKAAIGTGIDLSKDGILKASKAFKDLMWAV
ADVARAPFHDRQFDVVLSIFSPSNYAEFHRLLKNDGMLIKVVPRSDYLIELRQFLYTDSP
RRTYSNTAAVERFTANAAHSRPVRLRYVKTLDQQAIHWLLKMTPLAWSAPKDRVSLLKEM
KSADITVDVDILIGMK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
ttgatttgtacagaacgaggacatacatttgatctatctcggcacggctacgtgaacttt
ctgacgaagccggtcaaaaccagttacggtgccgagctttttgaagcgaggagcaggctg
attggagaatgtggtttttttgacccgctccatgatgcgattgcagagctcatcagtcat
cccaaatctggtcatgaggcattcaccatcttggacagcggttgcggtgagggttctcat
ttgaatgcgctttgcgggtttgattatgcagggaaagcagcgataggaaccggcatagat
ctttcgaaggacgggatcttaaaagcttctaaggcattcaaagatctgatgtgggcggtt
gccgatgtggcgcgtgctccttttcatgatcgccaatttgatgttgttctgtctattttt
tcgccgtccaattatgcagagtttcatagactgctgaagaatgatggcatgctcataaaa
gtagtgccgcgaagcgactatttaatagaattaaggcaatttttatatactgattcacca
aggcgcacgtattccaatacggcagcagttgagcgttttacagcaaatgcagcacacagc
cgtcctgtcaggctgcgctatgttaaaacgcttgaccagcaggcgatccactggcttctc
aagatgacgccgcttgcctggtcggcgccgaaagatcgagtcagcctgctgaaagagatg
aaatcagccgatattacggttgatgttgatatcctaataggaatgaaatga

DBGET integrated database retrieval system