KEGG   Brucella suis bv. 2 PT09143: BSPT1_I0209Help
Entry
BSPT1_I0209       CDS       T03503                                 

Definition
(GenBank) Thiaminase II
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
bsup  Brucella suis bv. 2 PT09143
Pathway
bsup00730  Thiamine metabolism
bsup01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsup00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BSPT1_I0209
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsup03000]
    BSPT1_I0209
Enzymes [BR:bsup01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     BSPT1_I0209
Transcription factors [BR:bsup03000]
 Prokaryotic type
  Other transcription factors
   Others
    BSPT1_I0209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4 NUDIX_4
Motif
Other DBs
NCBI-ProteinID: AIB20318
Position
I:complement(215124..215822)
Genome map
AA seq 232 aa AA seqDB search
MNLPQPHYSSELFTRLRTATLADWKPYIEHDFVRGLGDGTLPKAAFLHYLRQDYVYLHHY
ARAFALGVVKANTLQETRLCADIMHSLTHMELPLHVRICAREGISEDALYATREEPENLA
YTRYVLDCGQAGDFLDLLTALVPCAHGYGEIGLNLAATARAGTPYQEWIDTYAGSEYQDM
CRTVGRLFDQAARDRIGDDFEKSPRWPKLCQIFATASRLEADFWSMGLKAGS
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgccacagccgcattactcatccgaacttttcacgcgccttcgcactgccacg
cttgccgactggaagccctatatcgagcacgacttcgtgcgggggcttggcgacggcacg
ctaccgaaagccgccttcctgcattatctccggcaggattatgtctatctgcatcattat
gcccgcgcctttgcgctgggcgtggtcaaggccaatacattgcaggaaacgcggctttgc
gccgacatcatgcacagtctcacccatatggaactgcctttgcatgtgcgcatctgcgcc
cgtgaaggcatcagcgaagacgcgctttacgccacgcgggaggaaccggaaaaccttgcc
tatacgcgctatgtgctcgattgcggacaggcaggcgattttctcgatctgctgacagca
cttgtgccttgcgcgcacggctatggcgagatcggcctcaaccttgccgccacggccagg
gcgggcacgccctatcaggaatggatcgatacctatgccgggtctgaatatcaggacatg
tgccgcacggtcggcaggcttttcgatcaggccgcaagggaccgcatcggcgacgatttc
gagaaaagcccgcgctggccaaaactctgccagatttttgccacggcaagcaggctcgaa
gccgatttctggtccatgggcttgaaggccggatcgtga

DBGET integrated database retrieval system