KEGG   Brucella suis bv. 2 PT09143: BSPT1_I1694Help
Entry
BSPT1_I1694       CDS       T03503                                 

Definition
(GenBank) Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
bsup  Brucella suis bv. 2 PT09143
Brite
KEGG Orthology (KO) [BR:bsup00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSPT1_I1694
Enzymes [BR:bsup01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     BSPT1_I1694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AIB21770
Position
I:complement(1623575..1624429)
Genome map
AA seq 284 aa AA seqDB search
MSTFRAAAIQMRSGIDVVRNVEALEKLVADAAAQGAHYIQTPEMTGALMRDRPALFASVR
DEENDLVFRAARALAARHGVFLHIGSTAIDAGTGKIANRGGIFAPSGEKIATYDKIHMFD
VDLDNGESWRESAACEPGRQAVIAELPFAKVGMAICYDIRFPQLFQAQALAGANVITDPA
AFTRQTGEAHWHVLQRARAIENGAFLISAAQGGLHEDGRETYGHSIIVSPWGKVLAEAAH
DEPGVIVADIDLSESTAARAKVPNLKNAREFEVSLVCASQKEDA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgagcacctttcgcgctgccgcaatccagatgcgttcgggcattgatgtcgtccgcaat
gtggaggctctcgaaaaactggtcgcagatgcggcagcgcaaggcgcccattatatccag
acgccggaaatgaccggcgcgctgatgcgcgaccgtccggccctttttgcaagcgtgcgc
gatgaagagaacgacctggtcttccgggcggctcgcgcactggcggccaggcatggcgtc
ttcctgcatatcggttcgacggcaatcgatgcaggcaccggcaagatcgccaatcgcggc
gggatttttgcgccatcgggcgaaaagatcgccacttatgacaagattcatatgttcgat
gtcgatctcgacaatggcgaaagctggcgcgaatcggcggcctgtgagcccggcaggcaa
gccgtcatcgcggaactgcctttcgccaaagtgggcatggcgatctgctacgatatccgt
ttcccgcagctttttcaggcacaggcgctggctggcgcaaatgtcatcaccgaccctgct
gctttcacgcgccagactggtgaagcccattggcacgttctgcagcgcgcacgcgctatc
gagaatggcgcgttcctgatttccgcggcacagggcgggctgcatgaagatggccgtgaa
acctatggtcattcgattatcgtttcaccctggggcaaggtgctggcggaggctgcccat
gacgaacccggcgtgatcgttgccgatatcgacctgtcggaaagcacggcggcacgcgcc
aaggtgccgaacctgaagaatgcgcgggaatttgaggtgagcctcgtttgtgcgagccag
aaagaggatgcgtaa

DBGET integrated database retrieval system