KEGG   Brucella suis bv. 2 PT09143: BSPT1_II0733Help
Entry
BSPT1_II0733      CDS       T03503                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase / Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bsup  Brucella suis bv. 2 PT09143
Pathway
bsup00071  Fatty acid degradation
bsup00072  Synthesis and degradation of ketone bodies
bsup00280  Valine, leucine and isoleucine degradation
bsup00310  Lysine degradation
bsup00362  Benzoate degradation
bsup00380  Tryptophan metabolism
bsup00620  Pyruvate metabolism
bsup00630  Glyoxylate and dicarboxylate metabolism
bsup00640  Propanoate metabolism
bsup00650  Butanoate metabolism
bsup00900  Terpenoid backbone biosynthesis
bsup01100  Metabolic pathways
bsup01110  Biosynthesis of secondary metabolites
bsup01120  Microbial metabolism in diverse environments
bsup01130  Biosynthesis of antibiotics
bsup01200  Carbon metabolism
bsup01212  Fatty acid metabolism
bsup02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSPT1_II0733
   00630 Glyoxylate and dicarboxylate metabolism
    BSPT1_II0733
   00640 Propanoate metabolism
    BSPT1_II0733
   00650 Butanoate metabolism
    BSPT1_II0733
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSPT1_II0733
   00072 Synthesis and degradation of ketone bodies
    BSPT1_II0733
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSPT1_II0733
   00310 Lysine degradation
    BSPT1_II0733
   00380 Tryptophan metabolism
    BSPT1_II0733
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSPT1_II0733
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSPT1_II0733
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSPT1_II0733
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsup04147]
    BSPT1_II0733
Enzymes [BR:bsup01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BSPT1_II0733
Exosome [BR:bsup04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSPT1_II0733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AIB22808
Position
II:complement(735703..736911)
Genome map
AA seq 402 aa AA seqDB search
MAEAYIYDHVRTPRGRGKKDGSLHEVPAVRLGAKVLESLRDRNGIDTAKVDDIIFGCVDP
VGEAGAVIPRSAAFEAGYDFKAPGIQISRFCASGLDAINLAAAKVAFGSDDLVIAGGVES
MSRVGMGMSGGAWYMDPSVGFPGYFMPQGVSADLIATKYGFSRDDVDAYAVESQKRAANS
WEKGYFKNSVITIKDQNGLTILDRDEHMRPGTDMQALGQLNPSFVMPGEMGGFNAVGIQA
HPEIETVNHVHHAGNSSGIVDGAAGVLVGSRKAGKAFDIKPRARIRAFANIGSEPALMLT
GPVDVTEKLLKQAKMKISDIDLFELNEAFAAVVLRYMQAFDIPHDKINVNGGAIAMGHPL
GATGAMILGTVLDELERRNLNTALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggcttatatttacgatcacgtgcgcacgccgcgcgggcgcggcaagaaggac
ggctccctgcacgaagtgcctgccgttcgtctgggcgcgaaggttctggaatccctgcgc
gaccgcaacggcatcgacaccgccaaggtcgatgacattattttcggctgcgtcgatccg
gtcggcgaagcaggcgcggtcattccgcgttcggcggctttcgaggccggttatgatttc
aaggcgccgggcatccagatttcgcgcttctgcgcttcgggccttgatgccatcaatctg
gccgctgccaaggtggcattcggttcggatgatctggtgattgcgggcggcgtggaaagc
atgtcgcgcgtcggcatgggcatgtcgggcggcgcctggtacatggacccatcggttggc
ttccccggctatttcatgccgcagggcgtttccgccgacctgattgccaccaaatacggt
ttcagccgcgatgatgtcgatgcctatgctgtcgaaagccagaagcgcgctgccaattcg
tgggaaaagggctatttcaagaattcggtcatcacgatcaaggaccagaacggcctcacc
attctcgaccgtgacgagcatatgcgccccggcaccgacatgcaggcgctgggccagttg
aacccgtccttcgtgatgccgggcgaaatgggtggcttcaatgctgtcggcattcaggcg
cacccggaaatcgaaaccgtcaaccatgtccaccatgccggcaattcgtcgggcatcgtg
gatggcgcggcgggggttctcgtcggctccaggaaggctggcaaggccttcgatatcaag
ccgcgcgcgcgcattcgtgcttttgccaatatcggttcggaaccggcgcttatgctgacc
ggcccggtcgatgtgacggaaaagctgctgaaacaggccaagatgaagatttcggacatt
gatctgttcgagttgaacgaagccttcgccgcggtggtcctgcgctatatgcaggctttc
gatattccgcacgacaagatcaacgtcaatggcggcgccattgccatgggccatccgctc
ggtgccaccggcgcgatgatcctcggcacggtgctggatgaactggaacgccgcaatctc
aataccgctctggtgacgctgtgcatcggtgccggtatgggcacggccacgatcatcgag
cgcgtgtaa

DBGET integrated database retrieval system