KEGG   Brucella suis bv. 2 PT09143: BSPT1_II1210Help
Entry
BSPT1_II1210      CDS       T03503                                 

Definition
(GenBank) Octaprenyl diphosphate synthase / Dimethylallyltransferase / (2E,6E)-farnesyl diphosphate synthase / Geranylgeranyl diphosphate synthase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
bsup  Brucella suis bv. 2 PT09143
Pathway
bsup00900  Terpenoid backbone biosynthesis
bsup01100  Metabolic pathways
bsup01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsup00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSPT1_II1210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:bsup01006]
    BSPT1_II1210
Enzymes [BR:bsup01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     BSPT1_II1210
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     BSPT1_II1210
Prenyltransferases [BR:bsup01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   BSPT1_II1210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AIB23273
Position
II:1184277..1185191
Genome map
AA seq 304 aa AA seqDB search
MEKLPVDFTTLLNRRAMEVEAALAGLLDECPRTGEIARPQRLIAAMRHGVLNGGKRLRPF
LVLESAALFGQYGQAVLRVAAALECIHCYSLVHDDLPAMDDDDLRRGQPTVHKAFDEAAA
ILAGDSLLTYAFDIIASDETELDATTRIKLVCALTRASGLGGMAGGQALDLMAETRKPDE
AGIITLQAMKTGALIRFACEAGAIIAGASQEDRERMAEFGSAIGLAFQLADDLLDVTADA
GTMGKATGKDAAAGKATLVSLHGIDWTRQQLSGLVAQAESLLAPFGEDAEPLKQAARFIA
ERQN
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagctgcctgtcgatttcaccactcttcttaaccgccgcgccatggaagtagaa
gctgcccttgccggtcttctggacgaatgcccgcgcaccggcgagattgcccgtccgcag
cgtctcatcgccgccatgcgccatggcgtactgaacggcggcaagcgcctgcgcccgttt
ctcgtcctcgaaagtgctgcccttttcggacagtacggccaggcggtgctgcgcgtcgct
gccgcgctggaatgtatccattgctattcgctggtccatgacgatctgccagccatggat
gatgacgatctgcgccggggccagccaaccgtgcacaaggcctttgatgaggcagccgcc
attctggccggtgatagcctgctgacctacgccttcgacattatcgcatccgatgaaacg
gaactcgacgccaccacccgcataaagcttgtttgcgcgctcacgcgcgcttccggcctt
ggcggcatggcaggcggacaggcgctcgacctgatggcggaaaccagaaaaccggacgag
gcaggcatcatcacgcttcaagccatgaagaccggcgcgctgatccgctttgcctgcgag
gcgggcgctatcatcgctggcgcatcgcaggaagaccgggagcgcatggcggaattcggc
tcggcaatcggcctggccttccagcttgccgacgatcttctggacgtgaccgccgacgct
ggcaccatgggcaaggcaaccggcaaggatgccgccgccggaaaagccacgctggtttca
cttcacggcattgactggacccgccagcagctttcaggcctcgtcgcacaggccgaaagc
ctgctcgcaccctttggagaagacgccgaacccctcaagcaagcggcccgcttcatcgcc
gagcggcagaattaa

DBGET integrated database retrieval system