KEGG   Bacillus subtilis subsp. subtilis OH 131.1: Q433_00260Help
Entry
Q433_00260        CDS       T03469                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bsus  Bacillus subtilis subsp. subtilis OH 131.1
Pathway
bsus00450  Selenocompound metabolism
bsus00970  Aminoacyl-tRNA biosynthesis
bsus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsus00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Q433_00260
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Q433_00260
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsus01007]
    Q433_00260
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsus03016]
    Q433_00260
Enzymes [BR:bsus01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Q433_00260
Amino acid related enzymes [BR:bsus01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Q433_00260
Transfer RNA biogenesis [BR:bsus03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Q433_00260
 Prokaryotic type
   Other AARSs
    Q433_00260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AIC96686
Position
45525..47519
Genome map
AA seq 664 aa AA seqDB search
MPQENNTFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRLKGFDVRYLTGTDEHGQKIQ
QKAEQENITPQEYVDRAVADIQKLWKQLEISNDDFIRTTEKRHKVVIEKVFQKLLDNGDI
YLDEYEGWYSIPDETFYTETQLVDIERNEKGEVIGGKSPDSGHPVELIKEESYFFRMGKY
ADRLLKYYEENPTFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGVKVPENPKHVVYVW
IDALFNYLTALGYDTENDELYQKYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKQVF
AHGWLLMKDGKMSKSKGNVVDPVTLIERYGLDELRYYLLREVPFGSDGVFTPEGFVERIN
YDLANDLGNLLNRTVAMINKYFDGQIGSYKGAVTEFDQTLTSVAEETVKAYEKAMENMEF
SVALSTLWQLISRTNKYIDETAPWVLAKDPAKEEELRSVMYHLAESLRISAVLLQPFLTK
TPEKMFEQLGITDESLKAWDSITAFGQLKDTKVQKGEPLFPRLEAEEEIAYIKGKMQGSA
PAKEETKEEEPQEVDRLPEITIDQFMDVELRVAEVIEAEPVKKADRLLKLQLDLGFEKRQ
VVSGIAKHYTPEELVGKKLVCVTNLKPVKLRGELSQGMILAGEADGVLKVVSIDQSLPKG
TRIK
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaagaaaacaatacattttatattacaacaccgatttattatccgagcggaaaa
ttacatatcggccatgcatatacgacagtcgcgggagatgcaatggcacgttacaaaaga
ttaaaagggttcgatgttcgctatttaacgggaacggacgagcatggacaaaagatccag
caaaaagctgaacaggaaaacattacacctcaggagtatgtggatcgtgcagtggcagat
attcaaaaactgtggaagcagcttgaaatctcaaacgacgactttatccgcacgacagaa
aaacggcataaagttgtcattgaaaaagtgtttcaaaagcttcttgataacggggacatc
tatcttgatgagtatgaaggctggtacagcatccctgatgaaacgttctacacggaaact
cagctcgttgatattgagcggaatgaaaagggagaggtcatcggcggaaaaagccctgac
agcggtcacccagttgaattgatcaaagaggaatcttatttcttccgcatggggaaatac
gcggatcgccttctgaaatactatgaagaaaacccgacattcattcagccagaatcacgc
aaaaacgaaatgattaataactttatcaaacctggacttgaggatttggcagtatcacgt
accacttttgattggggcgtgaaggtgccggaaaatccaaagcatgttgtatatgtttgg
attgacgcactatttaactatttaacggcacttggttatgatacagaaaatgatgagctt
tatcaaaaatattggcctgccgatgttcatttagtcggtaaggagattgtacggttccat
accatttactggccaattatgctgatggctctggatcttccgctgccgaaacaggtattc
gcgcatggctggcttttgatgaaagacggaaaaatgtcgaaatcaaaaggaaacgttgta
gatccggttacattaattgaacgctatggtttagacgagcttcgctattacctgcttcgt
gaagtgccgttcggatctgacggtgttttcacgccggaaggatttgttgagcgaatcaac
tatgatttagcgaatgatttaggaaatctattgaatcgtactgttgcgatgatcaataag
tattttgacggacaaattggttcttacaaaggtgctgttacggaatttgaccaaacgctc
acttcggttgctgaagaaacagtgaaagcttatgagaaagcaatggaaaatatggagttc
tcggtagcactttcgactttatggcagctcatcagccgcacaaacaaatacattgatgag
acagctccatgggtgcttgcgaaagatccggcaaaagaagaagaattgcgatccgttatg
tatcatctcgctgaatcattgcgtatttcagcggtactgcttcagccattcttaacaaaa
acaccggaaaaaatgttcgagcagctgggcattaccgatgaatctctaaaagcttgggac
agcattacagctttcggccagctgaaagatacaaaagtacaaaaaggcgagccattgttc
cctcgtttagaggcagaagaagaaattgcttacatcaaagggaaaatgcaaggttcggca
ccagcgaaagaagaaacaaaagaagaagagccgcaagaggtcgatcgtttacctgaaatt
acgattgatcaatttatggatgtagagcttcgcgtagctgaggtcattgaggcagagcca
gtgaaaaaagcagaccgtttattgaagctgcagcttgatcttggttttgaaaagcgccaa
gtggtatccggcattgcgaagcattatacgcctgaagagcttgttggaaaaaaactcgtt
tgtgtaacaaatctaaaaccggttaaactcagaggagagctttctcaaggtatgatcctt
gcaggagaagcagacggcgttttaaaggtcgtgtctatcgatcagtcgttaccaaaaggc
acaagaattaaataa

DBGET integrated database retrieval system