KEGG   Bacillus subtilis subsp. subtilis OH 131.1: Q433_03270Help
Entry
Q433_03270        CDS       T03469                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
bsus  Bacillus subtilis subsp. subtilis OH 131.1
Pathway
bsus00730  Thiamine metabolism
bsus00790  Folate biosynthesis
bsus01100  Metabolic pathways
bsus02020  Two-component system
Module
bsus_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bsus00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Q433_03270
   00790 Folate biosynthesis
    Q433_03270
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Q433_03270
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsus04147]
    Q433_03270
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bsus00537]
    Q433_03270
Enzymes [BR:bsus01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Q433_03270
Exosome [BR:bsus04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Q433_03270
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bsus00537]
 Enzymes
  Q433_03270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AIC97168
Position
complement(583440..584828)
Genome map
AA seq 462 aa AA seqDB search
MKKFPKKLLPIAVLSSIAFSSLASGSVPDASAQEKKKGNQDEIKNVIVLIGDGMGVSYTS
AYRYLKDNKKTKVVEPTAFDQYLVGQQTTYPDDPEQNVTDSAAAATAMSAGIKTYNNAIA
VDNDGSEAKTVLEAAKEKGKATGLVATSEITHATPASFGSHDHSRKNMNSIADDYFDEMV
NGKHKIDVLLGGGKSNFDRKDRNLIKEFKKVGYSYVDNRKDMLKNKDSQVLGLFADGGLP
KKIDRTKDIPSLKDMTNTAIKKLNKDKDGFFLMVEGSQIDWAGHDNDIVGAMSEMEDFEQ
AYKAAIDFAKKDKHTLVVATADHSTGGYSIGADGIYNWFSEPIKAAKRTPDFMAEKIADG
ADVEKTLKTYIDQKKLALTKAEIQSVEEAAKSKEVLDIDNAIENIFNKRSHTGWTTGGHT
GEDVPVYAYGPSSETFAGQIDNTEIAKNVFKALQYNIKINDK
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaattcccgaagaaattactgcctatcgcggttttatcatcaattgcgttcagc
agcttagccagcggcagtgtgccagatgccagcgcccaggaaaagaaaaagggaaaccaa
gacgaaattaagaatgttattgttctgattggtgatggtatgggtgtgtcttatacgtcc
gcttatcgatacttaaaggataataaaaagacaaaagttgtggagcctacggcttttgat
cagtatcttgtcggccagcaaacaacttatcccgatgatcctgaacaaaatgtaacggat
tctgcagcggcggcaacggctatgtctgcgggaattaaaacatacaataatgccatagcc
gttgataacgacgggtcagaagccaaaacggtgcttgaagctgcgaaagaaaaaggaaaa
gcaacaggacttgtggccacttcagaaattacacacgccactccggcctcttttggttca
cacgaccacagccgaaaaaatatgaactcaattgcggatgattattttgatgagatggtc
aacggcaagcacaaaattgatgtccttctaggcggaggaaagagcaattttgaccgtaag
gaccgtaatttgatcaaggaattcaaaaaagtggggtacagctatgtggataatcgcaag
gacatgctgaaaaataaagacagccaagttctcggcctattcgctgacggcggccttcct
aaaaagattgaccgtacgaaggatattccatcacttaaagatatgacaaacacagccatt
aaaaaattaaacaaggataaagacggattcttcctcatggtggaaggcagccaaattgac
tgggcgggccatgacaatgatatcgtcggcgccatgagcgagatggaagacttcgaacaa
gcttataaggcggctattgatttcgctaaaaaagacaagcacacattggttgtcgcaacg
gctgaccactcaaccggcggatattccatcggtgcggacggcatctacaattggttcagt
gaacccattaaagccgcaaagcgcacaccagactttatggcagaaaagatcgctgacggc
gcggatgttgaaaaaacgttgaaaacatatatcgatcaaaagaaattggctttaacaaaa
gccgaaattcaatctgttgaagaagcggcaaaatcgaaggaagtactggatatcgataac
gcaatcgagaacatttttaataaacgctctcacactggatggacaacaggcggacatacc
ggtgaagatgtgcccgtctatgcatacggtccgtctagtgagacatttgccggccaaatc
gacaatacagaaatcgccaaaaatgtcttcaaggctttacaatacaacattaagattaac
gataaataa

DBGET integrated database retrieval system