KEGG   Bacillus subtilis subsp. subtilis OH 131.1: Q433_09200Help
Entry
Q433_09200        CDS       T03469                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bsus  Bacillus subtilis subsp. subtilis OH 131.1
Pathway
bsus00020  Citrate cycle (TCA cycle)
bsus00640  Propanoate metabolism
bsus00660  C5-Branched dibasic acid metabolism
bsus01100  Metabolic pathways
bsus01110  Biosynthesis of secondary metabolites
bsus01120  Microbial metabolism in diverse environments
bsus01130  Biosynthesis of antibiotics
bsus01200  Carbon metabolism
Module
bsus_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsus_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bsus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Q433_09200 (sucC)
   00640 Propanoate metabolism
    Q433_09200 (sucC)
   00660 C5-Branched dibasic acid metabolism
    Q433_09200 (sucC)
Enzymes [BR:bsus01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Q433_09200 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AIC98149
Position
1623114..1624271
Genome map
AA seq 385 aa AA seqDB search
MNIHEYQGKEVLRKYGVSVPEGKVAFTAEEAVESAKSLSSSVYVVKAQIHAGGRGKAGGV
KIAKSLDEVKAYAEELLGKTLVTHQTGPDGQVIKRLLIEEGCDIKKEYYIGLVLDRATSR
IVLMASEEGGTEIEEVAEKTPEKIKKAVIDPAVGLQGYQAREIAFAINIPKELVGKAAKF
MLGLYKAFVEKDCSIAEINPLVVTGDGNVMALDAKLNFDSNALYRQKDIMEYRDLDEEDP
KEIEASKYDLSYISLDGNIGCMVNGAGLAMSTMDIIKHYGGEPANFLDVGGGATAEKVTE
AFKIILSDQNVKGIFVNIFGGIMKCDVIAEGVVEATRQVGLTLPLVVRLEGTNVDLGKKI
LSESGLNITSAESMADGAQKIVSLV
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtaccagggaaaagaagtcctcagaaaatatggggtatctgttcct
gaaggtaaagtggcttttacagcagaagaagcagttgagagtgcaaagagcttatccagc
tcggtttatgtcgtaaaggctcaaattcatgctggcggtcgaggcaaagctggtggggta
aaaatagcaaaatcattagacgaagtaaaagcgtatgccgaagaactattagggaagacc
ctagttacacatcagacgggtccggacggccaagtaataaaacgcttacttattgaagaa
ggctgcgatattaaaaaagaatattacatcggtctagtgcttgaccgcgccacttcaaga
atcgttttgatggcttctgaagaaggcggaacggaaattgaagaggttgcggagaaaaca
ccggaaaaaatcaaaaaagctgtcattgatccggctgttggccttcaaggctatcaagcc
agagaaattgcatttgctattaatattccaaaagagctcgtgggaaaagctgctaaattt
atgcttggactatataaagcgtttgttgagaaagactgctcaatcgccgaaatcaatccg
cttgttgttaccggcgacggaaatgtgatggcgcttgatgcaaaattgaattttgacagc
aatgcgttgtaccgacaaaaggacattatggaatacagagatttggatgaagaagatccg
aaagaaattgaagcgtccaaatatgatctaagctacatttcccttgatggaaatatcggc
tgtatggtaaacggcgcggggcttgcaatgtccacgatggatattatcaagcattatgga
ggagaaccggccaacttccttgatgtgggcggcggtgcaaccgctgaaaaagtcacggaa
gcatttaaaatcattctttctgatcaaaacgttaaagggattttcgtcaacattttcggc
ggcattatgaaatgtgatgtcatcgcagaaggggttgttgaagcgactagacaagttggt
ttgacattgccgcttgtcgtccgtcttgaaggcacaaacgtggatctagggaagaaaatc
cttagtgaatcaggattaaacattacatctgcggaatcaatggctgacggcgcgcagaaa
atcgtatccttagtttaa

DBGET integrated database retrieval system