KEGG   Bacillus subtilis subsp. subtilis OH 131.1: Q433_13210Help
Entry
Q433_13210        CDS       T03469                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bsus  Bacillus subtilis subsp. subtilis OH 131.1
Pathway
bsus00071  Fatty acid degradation
bsus00072  Synthesis and degradation of ketone bodies
bsus00280  Valine, leucine and isoleucine degradation
bsus00310  Lysine degradation
bsus00362  Benzoate degradation
bsus00380  Tryptophan metabolism
bsus00620  Pyruvate metabolism
bsus00630  Glyoxylate and dicarboxylate metabolism
bsus00640  Propanoate metabolism
bsus00650  Butanoate metabolism
bsus00900  Terpenoid backbone biosynthesis
bsus01100  Metabolic pathways
bsus01110  Biosynthesis of secondary metabolites
bsus01120  Microbial metabolism in diverse environments
bsus01130  Biosynthesis of antibiotics
bsus01200  Carbon metabolism
bsus01212  Fatty acid metabolism
bsus02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Q433_13210
   00630 Glyoxylate and dicarboxylate metabolism
    Q433_13210
   00640 Propanoate metabolism
    Q433_13210
   00650 Butanoate metabolism
    Q433_13210
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Q433_13210
   00072 Synthesis and degradation of ketone bodies
    Q433_13210
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Q433_13210
   00310 Lysine degradation
    Q433_13210
   00380 Tryptophan metabolism
    Q433_13210
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Q433_13210
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Q433_13210
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Q433_13210
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsus04147]
    Q433_13210
Enzymes [BR:bsus01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Q433_13210
Exosome [BR:bsus04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Q433_13210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIC98811
Structure
PDB: 

Position
complement(2366738..2367919)
Genome map
AA seq 393 aa AA seqDB search
MRKTVIVSAARTPFGKFGGVLKEVKAAELGGIVMKEALQQAGVSGDDVEGNVMGMVVQAG
SGQIPSRQAARLAGMPWSVPSETLNKVCASGLRAVTLCDQMIRAQDADILVAGGMESMSN
IPYAVPAGRWGARMGDGELRDLMVYDGLTCAFDEVHMAVHGNTAAKEYAISRREQDEWAL
RSHARAAKAADEGKFQDEIVPVNWIGRKGKPNVVDKDEAIRRDTSLDQLAKLAPIYASDG
SITAGNAPGVNDGAGAFVLMSEEKAAELGKRPLATILGFSTTGMPAHELAAAPGFAINKL
LKKNGLTVQDIDLFEVNEAFASVVLTCEKIVGFDLEKVNVNGGAIALGHPIGASGARILM
TLVYELKRRGGGLGVAAICSGAAQGDAVLVQVH
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaaacagtcattgtaagtgctgcaagaactccatttggcaaattcggcggagtt
ttgaaagaggtgaaagctgctgagcttgggggcattgtgatgaaggaggcgctgcaacag
gctggagtctctggagatgatgtagaaggaaacgtcatgggcatggttgtccaggccggc
tcagggcagataccttcccgtcaagctgcccgtctggcgggaatgccttggagtgtgccc
tcagaaacactgaataaagtctgtgcttccggccttcgcgctgtcactttatgtgatcaa
atgattcgggcgcaggatgcggacatacttgttgcgggggggatggaaagcatgagcaat
attccgtatgccgttcccgccgggcgctggggagcacggatgggagacggcgagcttagg
gacttaatggtgtatgacggattaacgtgcgcatttgacgaggtgcacatggctgttcac
ggaaatacagctgccaaggaatatgcaatctcacgaagagagcaggacgaatgggcgttg
agaagtcatgcaagggcagctaaggcagccgatgaagggaagtttcaggatgaaattgtt
cccgtcaactggatcggccgaaaagggaaaccaaacgttgttgataaagatgaagcgatt
cgccgtgacacaagtctggatcagctcgcgaaacttgctccgatttatgcaagtgacggt
tctatcacagccggcaatgctcccggggtcaatgacggagccggcgcgttcgtgctgatg
tctgaggaaaaagctgctgagcttggcaaacggcctctggctacaattcttggtttttca
actacgggaatgccagcgcacgagctggcggcagcgccggggtttgccattaacaagctc
ctgaaaaagaacggtttgactgtccaagatattgacttgtttgaagtaaatgaagctttt
gcttcagttgttttgacatgtgaaaaaatcgtaggtttcgatcttgaaaaagtaaatgta
aatggcggtgcgatcgcgctcggccacccgatcggcgcgagcggggcgagaattctcatg
acgcttgtttatgaattaaagcgccggggagggggtctgggcgttgccgctatttgcagc
ggggcagcacagggagacgccgtcttagtgcaggttcattaa

DBGET integrated database retrieval system