KEGG   Bacillus subtilis subsp. subtilis OH 131.1: Q433_21180Help
Entry
Q433_21180        CDS       T03469                                 

Definition
(GenBank) aminopeptidase
  KO
K19701  aminopeptidase YwaD [EC:3.4.11.6 3.4.11.10]
Organism
bsus  Bacillus subtilis subsp. subtilis OH 131.1
Brite
KEGG Orthology (KO) [BR:bsus00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsus01002]
    Q433_21180
Enzymes [BR:bsus01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.6  aminopeptidase B
     Q433_21180
    3.4.11.10  bacterial leucyl aminopeptidase
     Q433_21180
Peptidases and inhibitors [BR:bsus01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   Q433_21180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M28 PA Peptidase_M20 DUF4910 Nicastrin
Motif
Other DBs
NCBI-ProteinID: AID00147
Position
3771237..3772604
Genome map
AA seq 455 aa AA seqDB search
MKKLLTVMTMAVLTAGTLLLPAQSVTPAAHALQISNSERELPFKAKHAYSTISQLSEAIG
PRIAGTAAEKKSALLIASSLRKLKLDVKVQRFNIPDRLEGTLSSAGRDILLQAASGSAPT
EEQGLTAPLYNAGLGYQKDFTADVKGKIALISRGDLTYYEKAKNAEAAGAKAVIIYNNKE
SLVPMTPNLSGNKVGIPVVGIKKEDGEALTQQKEATLKLKAFTNQTSQNIIGIKKPKNIK
HPDIVYVTAHYDSVPFSPGANDNGSGTSVMLEMARVLKSVPSDKEIRFIAFGAEELGLLG
SSHYVDHLSEKELKRSEVNFNLDMVGTSWEKASELYVNTLDGQSNYVWESSHTAAEKIGF
DSLSLTQGGSSDHVPFHEAGIDSANFIWGDPETEEVEPWYHTPEDSIEHISKERLQQAGD
LVTAAVYEAVKKEKKPKTIKKQMKAKASDIFEDIK
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcttttgactgtcatgacgatggctgttttaactgccggcacactgctcttg
ccggcacagagtgtcacccctgccgcgcacgctttacaaatatcaaatagcgagcgcgag
cttccattcaaagcaaagcatgcgtactctaccatttctcagctaagtgaagcaatcggc
cccagaatagccggaactgcagctgaaaaaaagagcgccctattgatcgcctcatccttg
agaaaattaaagcttgatgtgaaggttcaacgattcaacattcctgaccggcttgaggga
acactgtcttcagcaggacgcgatattcttctccaagcggcgtccggctcagctccgact
gaggaacaagggctgacggccccgctttacaatgcgggattgggctatcaaaaggacttt
accgctgacgtcaagggcaaaatcgccttgatttccagaggagacctgacttattacgag
aaagccaaaaatgccgaagccgccggagcaaaagctgtcatcatttataacaacaaagaa
agcctcgtgcctatgacgccaaacctgtcgggaaataaagtcggcattccggtcgtcggc
attaagaaagaagacggcgaagcacttacccagcaaaaagaagccaccttaaaactaaaa
gcattcacaaaccaaacctcccagaatatcatcggaatcaaaaaaccaaagaacatcaaa
catccagacattgtgtacgtgacggcccattacgacagtgttcctttttcacccggggca
aatgacaacggctcaggaacctctgttatgctggagatggcgcgtgtcttaaaaagcgtt
ccatctgataaagaaatccgctttatcgctttcggcgccgaagagctcggcctgctcggc
tcctctcactatgtagatcatctatcggaaaaagagctgaaacgaagtgaagtgaacttc
aacttagacatggtaggcacaagctgggaaaaagcgtctgagctgtatgtcaacacattg
gatggccaatctaactatgtttgggaatccagtcatacggctgctgaaaaaattggattt
gacagcctgtctctgacacagggaggatcatctgatcatgtgccattccacgaagccggc
attgattccgccaactttatttggggagacccggaaacagaagaagttgagccgtggtat
catacccctgaagactcgatcgaacatatcagcaaagaacgcctccagcaagcaggcgat
cttgtgacagccgctgtctatgaggctgtgaaaaaagagaagaaaccgaaaaccattaag
aaacaaatgaaggcgaaagcatctgacatttttgaagatatcaaataa

DBGET integrated database retrieval system