KEGG   Bacillus subtilis subsp. subtilis AG1839: BSUB_02591Help
Entry
BSUB_02591        CDS       T03442                                 

Gene name
mmgA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bsut  Bacillus subtilis subsp. subtilis AG1839
Pathway
bsut00071  Fatty acid degradation
bsut00072  Synthesis and degradation of ketone bodies
bsut00280  Valine, leucine and isoleucine degradation
bsut00310  Lysine degradation
bsut00362  Benzoate degradation
bsut00380  Tryptophan metabolism
bsut00620  Pyruvate metabolism
bsut00630  Glyoxylate and dicarboxylate metabolism
bsut00640  Propanoate metabolism
bsut00650  Butanoate metabolism
bsut00900  Terpenoid backbone biosynthesis
bsut01100  Metabolic pathways
bsut01110  Biosynthesis of secondary metabolites
bsut01120  Microbial metabolism in diverse environments
bsut01130  Biosynthesis of antibiotics
bsut01200  Carbon metabolism
bsut01212  Fatty acid metabolism
bsut02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSUB_02591 (mmgA)
   00630 Glyoxylate and dicarboxylate metabolism
    BSUB_02591 (mmgA)
   00640 Propanoate metabolism
    BSUB_02591 (mmgA)
   00650 Butanoate metabolism
    BSUB_02591 (mmgA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSUB_02591 (mmgA)
   00072 Synthesis and degradation of ketone bodies
    BSUB_02591 (mmgA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSUB_02591 (mmgA)
   00310 Lysine degradation
    BSUB_02591 (mmgA)
   00380 Tryptophan metabolism
    BSUB_02591 (mmgA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSUB_02591 (mmgA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSUB_02591 (mmgA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSUB_02591 (mmgA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsut04147]
    BSUB_02591 (mmgA)
Enzymes [BR:bsut01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BSUB_02591 (mmgA)
Exosome [BR:bsut04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSUB_02591 (mmgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIC45102
Structure
PDB: 

Position
complement(2485627..2486808)
Genome map
AA seq 393 aa AA seqDB search
MRKTVIVSAARTPFGKFGGVLKEVKAAELGGIVMKEALQQAGVSGDDVEGNVMGMVVQAG
SGQIPSRQAARLAGMPWSVPSETLNKVCASGLRAVTLCDQMIRAQDADILVAGGMESMSN
IPYAVPAGRWGARMGDGELRDLMVYDGLTCAFDEVHMAVHGNTAAKEYAISRREQDEWAL
RSHARAAKAADEGKFQDEIVPVNWIGRKGKPNVVDKDEAIRRDTSLDQLAKLAPIYASDG
SITAGNAPGVNDGAGAFVLMSEEKAAELGKRPLATILGFSTTGMPAHELAAAPGFAINKL
LKKNGLTVQDIDLFEVNEAFASVVLTCEKIVGFDLEKVNVNGGAIALGHPIGASGARILM
TLVYELKRRGGGLGVAAICSGAAQGDAVLVQVH
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaaacagtcattgtaagtgctgcaagaactccatttggcaaattcggcggagtt
ttgaaagaggtgaaagctgctgagcttgggggcattgtgatgaaggaggcgctgcaacag
gctggagtctctggagatgatgtagaaggaaacgtcatgggcatggttgtccaggccggc
tcagggcagataccttcccgtcaagctgcccgtctggcgggaatgccttggagtgtgccg
tcagaaacactgaataaagtctgtgcttccggccttcgcgctgtcactttatgtgatcaa
atgattcgggcgcaggatgcggacatacttgttgcgggggggatggaaagcatgagcaat
attccgtatgccgttcccgccgggcgctggggagcacggatgggggacggcgagcttagg
gacttaatggtgtatgacggattaacgtgcgcatttgacgaggtgcacatggctgttcac
ggaaatacagctgccaaggaatatgcaatctcacgaagagagcaggacgaatgggcgttg
agaagtcatgcaagggcagctaaggccgccgatgaagggaagtttcaggatgaaattgtt
cccgtcaactggatcggtcgaaaaggaaaaccaaacgttgttgataaagatgaagcgatt
cgccgtgacacaagtctggatcagctcgcaaaacttgctccgatttatgcaagtgacggt
tctatcacagccggcaatgctcctggagtcaatgacggagccggcgcgttcgtgctgatg
tctgaggaaaaagctgctgagcttggcaaacggcctctggctacaattcttggtttttca
actacgggaatgccagcgcacgagctggcggcagcgccagggtttgctattaacaagctc
ctgaaaaagaatggtttaactgtccaagatattgacttgtttgaagtaaatgaagctttt
gcttcagttgttttgacatgtgaaaaaatcgtaggtttcgatcttgaaaaagtaaatgtg
aatggcggtgcgatcgcgctcggccacccgatcggcgcgagcggtgcgagaattctcatg
acgcttgtttatgaattaaagcgacggggagggggtctgggcgttgccgctatttgcagc
ggggcagcacagggagacgccgtcttagtgcaggttcattaa

DBGET integrated database retrieval system