KEGG   Bacillus subtilis subsp. subtilis AG1839: BSUB_03322
Entry
BSUB_03322        CDS       T03442                                 

Definition
(GenBank) bslA
Organism
bsut  Bacillus subtilis subsp. subtilis AG1839
SSDB
Motif
Pfam: BslA A2M_recep
Other DBs
NCBI-ProteinID: AIC45804
Structure
PDB: 
4BHU

Position
3165541..3166086
AA seq 181 aa
MKRKLLSSLAISALSLGLLVSAPTASFAAESTSTKAHTESTMRTQSTASLFATITGASKT
EWSFSDIELTYRPNTLLSLGVMEFTLPSGFTANTKDTLNGNALRTTQILNNGKTVRVPLA
LDLLGAGEFKLKLNNKTLPAAGTYTFRAENKSLSIGNKFYAEASIDVAKRSTPPTQPCGC
N
NT seq 546 nt   +upstreamnt  +downstreamnt
atgaaacgcaaattattatcttctttggcaattagtgcattaagtctcgggttactcgtt
tctgcacctacagcttctttcgcggctgaatctacatcaactaaagctcatactgaatcc
actatgagaacacagtctacagcttcattgttcgcaacaatcactggcgccagcaaaacg
gaatggtctttctcagatatcgaattgacttaccgtccaaacacgcttctcagccttggc
gttatggagtttacattgccaagcggatttactgcaaacacgaaagacacattgaacgga
aatgccttgcgtacaacacagatcctcaataacgggaaaacagtaagagttcctttggca
cttgatttgttaggagctggcgaattcaaattaaaactgaataacaaaacacttcctgcc
gctggtacatatactttccgtgcggagaataaatcattaagcatcggaaataaattttac
gcagaagccagcattgacgtggctaagcgcagcactcctccgactcagccttgcggttgc
aactaa

DBGET integrated database retrieval system