KEGG   Bacillus subtilis subsp. subtilis AG1839: BSUB_04228Help
Entry
BSUB_04228        CDS       T03442                                 

Gene name
aldX
Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bsut  Bacillus subtilis subsp. subtilis AG1839
Pathway
bsut00010  Glycolysis / Gluconeogenesis
bsut00053  Ascorbate and aldarate metabolism
bsut00071  Fatty acid degradation
bsut00280  Valine, leucine and isoleucine degradation
bsut00310  Lysine degradation
bsut00330  Arginine and proline metabolism
bsut00340  Histidine metabolism
bsut00380  Tryptophan metabolism
bsut00410  beta-Alanine metabolism
bsut00561  Glycerolipid metabolism
bsut00620  Pyruvate metabolism
bsut00625  Chloroalkane and chloroalkene degradation
bsut01100  Metabolic pathways
bsut01110  Biosynthesis of secondary metabolites
bsut01120  Microbial metabolism in diverse environments
bsut01130  Biosynthesis of antibiotics
Module
bsut_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:bsut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSUB_04228 (aldX)
   00053 Ascorbate and aldarate metabolism
    BSUB_04228 (aldX)
   00620 Pyruvate metabolism
    BSUB_04228 (aldX)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSUB_04228 (aldX)
   00561 Glycerolipid metabolism
    BSUB_04228 (aldX)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSUB_04228 (aldX)
   00310 Lysine degradation
    BSUB_04228 (aldX)
   00330 Arginine and proline metabolism
    BSUB_04228 (aldX)
   00340 Histidine metabolism
    BSUB_04228 (aldX)
   00380 Tryptophan metabolism
    BSUB_04228 (aldX)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BSUB_04228 (aldX)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BSUB_04228 (aldX)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BSUB_04228 (aldX)
Enzymes [BR:bsut01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BSUB_04228 (aldX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC HXXSHH
Motif
Other DBs
NCBI-ProteinID: AIC46704
Position
4072013..4073350
Genome map
AA seq 445 aa AA seqDB search
MEQQVKDDIQRVFQLQKKQQKALRASTAEQRREKLQRFLDSVIAHEEEIIEAIRKDVRKP
YHEVKKAEIEGTKKAIRDNMNNLEQWMAPKEVGSSLSPDANGILMYEPKGVTLILGPWNY
PFMLTMAPLAASLAAGNSAIVKLSDFTMNTSNIAAKVIRDAFDEKEVAIFEGEVEVATEL
LDQPFDHIFFTGSTNVGKIVMTAAAKHLASVTLELGGKSPTIIDSEYDLMDAAKKIAVGK
FVNAGQTCIAPDYLFIKKDVQDRFAGILQTVVNAGFMEDDHTPDRSKFTQIVNDRNFNRV
KDLFDDAIERGAEVVFGGVFDASDRTISPTVLKNVTPDMKIMQEEIFASILPMMNYEDID
EVIDYVNDRDKPLALYVFSKNQDLIDNVLQHTTSGNAAINDVVVHFSDVNLPFGGVNTSG
IGSYHGVYGFKEFSHEKGVFIQAAE
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggaacagcaagtaaaggacgacatccagcgtgtctttcagcttcagaaaaaacagcaa
aaagccttgcgcgcttcaacagcggaacagcggagagaaaagcttcaacgctttttagat
tccgtcatcgcccatgaagaagaaatcatcgaagcgatccgcaaagacgtccgcaaacca
tatcacgaagtcaaaaaagcggaaatcgaaggaacaaaaaaagcgattagagataatatg
aataacctggaacaatggatggcgcctaaagaagtcggttcatcgttaagccctgacgca
aacggaattcttatgtacgagcctaaaggcgtcacactcatcctcggcccgtggaactat
ccgtttatgctgacgatggcgccgcttgccgcttctctcgcagccggaaacagcgcgatt
gtgaagctgtccgatttcacgatgaacacgagcaacattgctgctaaagtaataagagac
gcttttgatgaaaaagaagtcgcgatttttgaaggagaggttgaggtggcaaccgaacta
cttgatcagccgttcgaccatattttcttcactggaagcacaaatgtcgggaaaattgtc
atgacagcggctgccaaacacttggcatctgtcacacttgagcttggcggcaagagcccg
acgatcattgacagtgaatacgatctgatggacgcagcgaaaaagatcgccgtcgggaaa
ttcgtaaacgccggccaaacctgcatcgcacctgattacctgttcattaaaaaagacgtt
caggacaggttcgcggggattttacaaacagtcgtcaacgctggatttatggaggatgat
cataccccagaccgcagcaaatttacgcagatcgtcaatgaccgcaacttcaaccgcgtc
aaagatctgttcgacgatgccatcgaaagaggggcggaagtggtgttcggcggcgtattc
gatgccagcgaccgcacgatctcgccaaccgttttgaaaaacgtcacgcctgacatgaaa
atcatgcaggaggaaatcttcgcatcgatcctgccaatgatgaactatgaagacatcgac
gaggtcatcgattacgtaaatgaccgcgataaaccgcttgcactttatgtgttcagcaaa
aaccaagatctgattgacaacgtccttcagcacacgacatcaggaaatgccgccatcaat
gatgtcgtcgtccatttcagtgacgtcaacctgccattcggcggcgtcaacacaagcgga
atcggctcctatcatggggtatacggattcaaagagttttctcatgagaagggtgtattt
attcaggccgctgaataa

DBGET integrated database retrieval system