KEGG   Brucella suis bv. 2 PT09172: BSPT2_I1476Help
Entry
BSPT2_I1476       CDS       T03504                                 

Definition
(GenBank) ATP synthase delta chain
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
bsuv  Brucella suis bv. 2 PT09172
Pathway
bsuv00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:bsuv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSPT2_I1476
Enzymes [BR:bsuv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     BSPT2_I1476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer Cupin_2
Motif
Other DBs
NCBI-ProteinID: AIB24932
Position
I:complement(1434005..1434691)
Genome map
AA seq 228 aa AA seqDB search
MKRSEINEIIRESDAFIRSFGYIMPPFAYWSPEELKPRTAGDVAAIRKARLGWDITDYGQ
GKFADLGLFLFTVRNGNAEDLKRGTGMLYAEKIMISRKNQLSPMHRHVVKAEDIINRGGG
TLVLELFNSRPDGSVDEETDVTVATDGRLVTQKAGAHLKLQPGESVTLLPGNWHAFWGEG
GDVLIGEVSTVNDDLTDNIFREPIGRFSDIEENEQPLHLLVSDYDKWL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgctctgaaatcaatgaaatcatccgtgaaagcgatgcctttatccgctcgttc
ggttatatcatgccgccctttgcctattggtcgccggaagagctgaagccgcgcacggct
ggcgatgtggcggcgatccgcaaggcgcggcttggctgggatattaccgattacgggcag
ggcaagtttgccgatctcggcctgtttcttttcacggttcgcaatggcaatgccgaggac
ctgaagcgtggtacaggcatgctctatgccgaaaagatcatgatttcgcgtaaaaatcag
ctttcccccatgcatcgccatgtggtgaaggcggaagatatcatcaatcgcggtggcggg
acgctggtgctggaattgttcaattcgcggcctgatggcagcgtggacgaggaaaccgac
gtgactgtggcgaccgatgggcggcttgttacccagaaggcgggcgcgcatctgaagctc
cagcccggcgagagcgtaacgctcctgcccggcaattggcacgctttctggggtgagggc
ggcgatgtgctgatcggtgaggtttcgactgtcaatgacgatctgaccgacaatatcttc
cgcgagccgattggccgcttctcggatatcgaggaaaacgagcagcccttgcatctgctt
gtgtctgattacgacaagtggctatag

DBGET integrated database retrieval system