KEGG   Brucella suis bv. 2 PT09172: BSPT2_II0735Help
Entry
BSPT2_II0735      CDS       T03504                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase / Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bsuv  Brucella suis bv. 2 PT09172
Pathway
bsuv00071  Fatty acid degradation
bsuv00072  Synthesis and degradation of ketone bodies
bsuv00280  Valine, leucine and isoleucine degradation
bsuv00310  Lysine degradation
bsuv00362  Benzoate degradation
bsuv00380  Tryptophan metabolism
bsuv00620  Pyruvate metabolism
bsuv00630  Glyoxylate and dicarboxylate metabolism
bsuv00640  Propanoate metabolism
bsuv00650  Butanoate metabolism
bsuv00900  Terpenoid backbone biosynthesis
bsuv01100  Metabolic pathways
bsuv01110  Biosynthesis of secondary metabolites
bsuv01120  Microbial metabolism in diverse environments
bsuv01130  Biosynthesis of antibiotics
bsuv01200  Carbon metabolism
bsuv01212  Fatty acid metabolism
bsuv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsuv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSPT2_II0735
   00630 Glyoxylate and dicarboxylate metabolism
    BSPT2_II0735
   00640 Propanoate metabolism
    BSPT2_II0735
   00650 Butanoate metabolism
    BSPT2_II0735
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSPT2_II0735
   00072 Synthesis and degradation of ketone bodies
    BSPT2_II0735
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSPT2_II0735
   00310 Lysine degradation
    BSPT2_II0735
   00380 Tryptophan metabolism
    BSPT2_II0735
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSPT2_II0735
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSPT2_II0735
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSPT2_II0735
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsuv04147]
    BSPT2_II0735
Enzymes [BR:bsuv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BSPT2_II0735
Exosome [BR:bsuv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSPT2_II0735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AIB26165
Position
II:complement(735746..736954)
Genome map
AA seq 402 aa AA seqDB search
MAEAYIYDHVRTPRGRGKKDGSLHEVPAVRLGAKVLESLRDRNGIDTAKVDDIIFGCVDP
VGEAGAVIPRSAAFEAGYDFKAPGIQISRFCASGLDAINLAAAKVAFGSDDLVIAGGVES
MSRVGMGMSGGAWYMDPSVGFPGYFMPQGVSADLIATKYGFSRDDVDAYAVESQKRAANS
WEKGYFKNSVITIKDQNGLTILDRDEHMRPGTDMQALGQLNPSFVMPGEMGGFNAVGIQA
HPEIETVNHVHHAGNSSGIVDGAAGVLVGSRKAGKAFDIKPRARIRAFANIGSEPALMLT
GPVDVTEKLLKQAKMKISDIDLFELNEAFAAVVLRYMQAFDIPHDKINVNGGAIAMGHPL
GATGAMILGTVLDELERRNLNTALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggcttatatttacgatcacgtgcgcacgccgcgcgggcgcggcaagaaggac
ggctccctgcacgaagtgcctgccgttcgtctgggcgcgaaggttctggaatccctgcgc
gaccgcaacggcatcgacaccgccaaggtcgatgacattattttcggctgcgtcgatccg
gtcggcgaagcaggcgcggtcattccgcgttcggcggctttcgaggccggttatgatttc
aaggcgccgggcatccagatttcgcgcttctgcgcttcgggccttgatgccatcaatctg
gccgctgccaaggtggcattcggttcggatgatctggtgattgcgggcggcgtggaaagc
atgtcgcgcgtcggcatgggcatgtcgggcggcgcctggtacatggacccatcggttggc
ttccccggctatttcatgccgcagggcgtttccgccgacctgattgccaccaaatacggt
ttcagccgcgatgatgtcgatgcctatgctgtcgaaagccagaagcgcgctgccaattcg
tgggaaaagggctatttcaagaattcggtcatcacgatcaaggaccagaacggcctcacc
attctcgaccgtgacgagcatatgcgccccggcaccgacatgcaggcgctgggccagttg
aacccgtccttcgtgatgccgggcgaaatgggtggcttcaatgctgtcggcattcaggcg
cacccggaaatcgaaaccgtcaaccatgtccaccatgccggcaattcgtcgggcatcgtg
gatggcgcggcgggggttctcgtcggctccaggaaggctggcaaggccttcgatatcaag
ccgcgcgcgcgcattcgtgcttttgccaatatcggttcggaaccggcgcttatgctgacc
ggcccggtcgatgtgacggaaaagctgctgaaacaggccaagatgaagatttcggacatt
gatctgttcgagttgaacgaagccttcgccgcggtggtcctgcgctatatgcaggctttc
gatattccgcacgacaagatcaacgtcaatggcggcgccattgccatgggccatccgctc
ggtgccaccggcgcgatgatcctcggcacggtgctggatgaactggaacgccgcaatctc
aataccgctctggtgacgctgtgcatcggtgccggtatgggcacggccacgatcatcgag
cgcgtgtaa

DBGET integrated database retrieval system