KEGG   Brucella suis bv. 2 PT09172: BSPT2_II1058Help
Entry
BSPT2_II1058      CDS       T03504                                 

Definition
(GenBank) Amidase family protein
  KO
K01426  amidase [EC:3.5.1.4]
Organism
bsuv  Brucella suis bv. 2 PT09172
Pathway
bsuv00330  Arginine and proline metabolism
bsuv00360  Phenylalanine metabolism
bsuv00380  Tryptophan metabolism
bsuv00627  Aminobenzoate degradation
bsuv00643  Styrene degradation
bsuv01100  Metabolic pathways
bsuv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsuv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BSPT2_II1058
   00360 Phenylalanine metabolism
    BSPT2_II1058
   00380 Tryptophan metabolism
    BSPT2_II1058
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BSPT2_II1058
   00643 Styrene degradation
    BSPT2_II1058
Enzymes [BR:bsuv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     BSPT2_II1058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AIB26483
Position
II:1048941..1049957
Genome map
AA seq 338 aa AA seqDB search
MDLTELSAARLVNMMGKRQTSPSEVMAAHLDRIERHNGAVNAMVAMRSRDELIAEARLLD
DKPVCGPLHGLPWAIKDLLPTKDIRSTWGSPIHADYIPAEDALAVSRIRKAGAVIMGKTN
TPEWGHGSHSFNPVYGITCNPYDTQLSAGGSSGGTAAALAARFMPLGDGSDMMGSLRNPA
GFCNIYGYRPSWGLVPNEIGGDLFVHTMATLGPMARDIEDLVLLLDVLAEPYSLSPFGQK
HTGFATNHAPADLRGKRIAWLGNWGGAYPCEAGILERCEKGLAVLSELGAEIVPLEPPFS
SQALWEAWITLRSLVIYGSKRALWEKPEAHQARNALGN
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
ttggacctgaccgaactttccgccgcgcgccttgtgaacatgatgggaaaaaggcagact
tccccctccgaagtgatggccgcgcatcttgatcgtatcgagcggcataacggagccgtc
aacgccatggtcgccatgcgttcccgcgacgagctgattgccgaagcccggttgctggat
gacaaaccagtttgcgggccactgcatggattgccctgggcgatcaaggatcttctgcca
acaaaagatattcgctccacctggggctctcctattcatgctgattacattccggcagaa
gatgccctagcagtgagccgcatccgaaaggccggcgccgtcatcatgggcaagacaaat
acgcccgaatggggccatggtagccacagtttcaatcccgtctacggcatcacctgtaat
ccctacgatactcaattaagtgccggtggctcctcgggcggaactgcagccgcgcttgcc
gcccgctttatgcccctgggcgacggatcggatatgatgggaagtctgcgcaatcccgca
ggcttctgcaatatttatggctatcggccaagctggggacttgtgcccaatgaaattggc
ggcgatctctttgtacacaccatggccactctgggccccatggcacgtgatattgaggat
ctcgttctgctgcttgacgttctggccgagccgtattcactgagcccttttggacagaag
cacaccgggtttgccacgaaccacgcacccgcagaccttcggggcaaacgcattgcctgg
cttggcaactggggaggagcatatccgtgtgaagcaggcattctggagcgttgcgagaag
ggccttgccgtcctgagcgagcttggcgccgagatcgtcccgctcgaaccgcctttttct
tcccaagccctatgggaagcatggatcacccttcgttcactggtgatctatggttccaag
cgcgccctatgggaaaagccggaagctcatcaagcccgaaacgctttgggaaattga

DBGET integrated database retrieval system