KEGG   Brucella suis VBI22: BSVBI22_A0245Help
Entry
BSVBI22_A0245     CDS       T01706                                 

Definition
(GenBank) mandelate racemase/muconate lactonizing protein
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
bsv  Brucella suis VBI22
Pathway
bsv00051  Fructose and mannose metabolism
bsv01100  Metabolic pathways
bsv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BSVBI22_A0245
Enzymes [BR:bsv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     BSVBI22_A0245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C Kin17_mid
Motif
Other DBs
NCBI-ProteinID: AEU05274
Position
I:255621..256898
Genome map
AA seq 425 aa AA seqDB search
MTKITDLRVFDLRFPTSQSLDGSDAMNPDPDYSAAYVILDTDDEALKGHGLTFTIGRGND
ICCHAILAMRHLVVGASLDEIRAAPGKFWHHLTGDSQLRWIGPEKGAMHLATGAVVNAIW
DLLAKQAGKPVWRLVSELSPEEIADIVDYRYLTDVLTRDEAIEILRKAESGKAERIATLE
AEGYACYTTSAGWLGYDDAKLRRLCQEAIDEGFNHVKMKVGHDLEDDIRRLTIAREVIGP
DRYLMIDANQVWEVDQAIEWVRRLAFANPFFIEEPTSPDDVAGHRKIRAAIGPVKVATGE
MCQNRIMFKQFIAEGAIDVVQIDSCRMGGLNEVLAVLLMAAKYDLPVWPHAGGVGLCEYV
QHLSMIDYVAVSGTKEGRVIEYVDHLHEHFLDPCIIRNAAYMPPSLPGFSIEMKPQSIAQ
YAFKG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaatcaccgatctgcgcgttttcgacctgcgctttccgacgtcgcaaagtctg
gacggctcggatgcgatgaatcccgacccggactattcggcggcctatgtcatcctcgat
acggatgatgaggcgctgaaagggcacggccttaccttcaccatcggccgcggtaacgat
atttgctgccatgcgatcctggccatgcgccatctggtcgtgggggcttcgcttgatgaa
atccgtgccgcccccggcaagttctggcatcacctgacgggtgacagccagttgcgctgg
atcggcccggagaagggcgccatgcaccttgccaccggcgctgtggtcaacgcgatctgg
gatttgcttgcgaaacaagcgggaaagccggtctggcggctggtctcggagctttcgccg
gaagaaatcgccgatatcgtggattatcgttatctgaccgatgtgctgacgcgcgatgaa
gccatcgaaattctgcggaaggctgaaagcggcaaggcagagcgtatcgccacgctggag
gcggagggctatgcctgctacacgacctctgctggctggcttggctatgacgacgcgaaa
ttgcgccggctttgccaagaagcgatcgatgaaggcttcaaccacgtcaagatgaaggtg
ggccacgatctggaagacgatatccgccgcctgaccatcgcgcgagaggttatcgggccg
gaccgttatctcatgatcgacgccaaccaggtgtgggaagtcgatcaggccattgagtgg
gtgaggcggcttgcctttgccaatccgttcttcatcgaggaaccgaccagccccgacgat
gtggccgggcatcgcaagattcgcgccgcaattggtccggtgaaggttgccaccggcgaa
atgtgccagaaccgcatcatgttcaagcagtttatcgcggaaggtgcgatcgacgtcgtg
cagatcgatagctgccgcatgggtggcctgaacgaggtgctggcagtgctgctgatggca
gcaaagtatgaccttccggtctggcctcacgcgggcggtgtgggcttgtgcgaatatgtg
cagcacctgtctatgatcgattatgtggctgtctccggtaccaaggaaggccgtgtgatc
gaatatgtcgatcacctgcacgaacatttcctcgatccctgcattatcaggaacgcggcc
tatatgccgccttcgctgcctggcttttccatcgagatgaagccgcaatccatcgcgcaa
tatgcattcaagggctga

DBGET integrated database retrieval system