KEGG   Brucella suis VBI22: BSVBI22_B0444Help
Entry
BSVBI22_B0444     CDS       T01706                                 

Gene name
phbA-2
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bsv  Brucella suis VBI22
Pathway
bsv00071  Fatty acid degradation
bsv00072  Synthesis and degradation of ketone bodies
bsv00280  Valine, leucine and isoleucine degradation
bsv00310  Lysine degradation
bsv00362  Benzoate degradation
bsv00380  Tryptophan metabolism
bsv00620  Pyruvate metabolism
bsv00630  Glyoxylate and dicarboxylate metabolism
bsv00640  Propanoate metabolism
bsv00650  Butanoate metabolism
bsv00900  Terpenoid backbone biosynthesis
bsv01100  Metabolic pathways
bsv01110  Biosynthesis of secondary metabolites
bsv01120  Microbial metabolism in diverse environments
bsv01130  Biosynthesis of antibiotics
bsv01200  Carbon metabolism
bsv01212  Fatty acid metabolism
bsv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSVBI22_B0444 (phbA-2)
   00630 Glyoxylate and dicarboxylate metabolism
    BSVBI22_B0444 (phbA-2)
   00640 Propanoate metabolism
    BSVBI22_B0444 (phbA-2)
   00650 Butanoate metabolism
    BSVBI22_B0444 (phbA-2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSVBI22_B0444 (phbA-2)
   00072 Synthesis and degradation of ketone bodies
    BSVBI22_B0444 (phbA-2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSVBI22_B0444 (phbA-2)
   00310 Lysine degradation
    BSVBI22_B0444 (phbA-2)
   00380 Tryptophan metabolism
    BSVBI22_B0444 (phbA-2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSVBI22_B0444 (phbA-2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSVBI22_B0444 (phbA-2)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSVBI22_B0444 (phbA-2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsv04147]
    BSVBI22_B0444 (phbA-2)
Enzymes [BR:bsv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BSVBI22_B0444 (phbA-2)
Exosome [BR:bsv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSVBI22_B0444 (phbA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEU07591
Position
II:complement(435999..437189)
Genome map
AA seq 396 aa AA seqDB search
MSKSDPIVIVGASRTPMGGFQGDFTNAQATDLGASAIGGALAGAGLAPEAVEEVIMGCVL
PAGQGQAPARQASLKAGLPLGTGATTVNKMCGSGMKAAMLAHDLILAGSADVIVAGGMES
MTNAPYLLPKARGGYRMGHGQVLDHMFLDGLEDAYDKGRLMGTFAEDCAEAYQFTREAQD
AFAISSLTRAQNAIKDGLFAAEITPVKVKSGRAEVEVTIDEQPGKAKLDKIPTLRPAFRE
GGTVTAANSSSISDGAAALLLMRASEAEKRGLTPHAVITGHATYADKPNLFSTAPIGAIR
KLSEKTGWDLKDVDLFEINEAFAVVAMAAMRDLDLPHDKVNIHGGACALGHPIGASGARI
LVTLLAALETHGLKRGIAGICLGGGEATAMGIERII
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagagcgatcctattgtcatcgtcggtgcttcgcgcacccccatgggcggtttt
cagggtgacttcacaaatgcgcaggcaaccgaccttggcgcttccgccatcggcggcgcg
cttgccggtgcaggccttgccccggaagccgtcgaggaggttatcatgggctgtgtcctg
cctgctggtcagggtcaggcgcctgcgcgtcaggcctcgctcaaggccgggctgccgctt
ggcaccggtgccacgaccgtcaacaagatgtgcggctcgggcatgaaggccgcgatgctt
gcccatgacctcatccttgccggttccgccgatgtcatcgtcgcgggcggcatggaaagc
atgacaaatgccccctatcttctgcccaaggcgcgcgggggctatcgcatgggccatgga
caggtgctcgaccatatgttcctcgatgggctggaagatgcctatgacaaggggcgcctg
atgggcacgtttgcggaagattgcgccgaggcctaccagttcacgcgcgaggcgcaggac
gcatttgcgatatcctccctgacccgcgcgcagaacgcgatcaaggatggtctttttgcg
gcggaaatcacgccggtcaaggtcaagtccggccgcgccgaggtggaagttaccattgac
gagcagccgggcaaggcaaagctggacaagatccccacgctgcgccccgccttccgcgaa
ggcggcacggtaacggcggccaattcctcttccatttccgatggcgcggcagcacttctg
ctcatgcgcgcatcggaggcagaaaaacgtggcctcaccccgcacgcggtcatcaccggc
cacgcaacctatgccgacaagccaaatctcttctccacggcccccattggcgcgatccgc
aaactgtctgaaaagactggctgggatttgaaggatgtcgatctcttcgagatcaatgaa
gcctttgccgttgttgccatggccgccatgcgcgatctcgacctgccgcacgacaaggtc
aatattcatggcggcgcctgtgcacttggccaccccatcggcgcatcgggcgcacgtatt
ctcgtaaccctgctggcggcacttgaaacacatggcctgaagcgcggcatcgcgggcatc
tgccttggcggcggcgaggcaaccgcaatgggtatcgaaaggatcatctga

DBGET integrated database retrieval system