KEGG   Brucella suis ZW043: IY71_00430Help
Entry
IY71_00430        CDS       T03426                                 

Definition
(GenBank) 3-oxoacid CoA-transferase
  KO
K01032  3-oxoadipate CoA-transferase, beta subunit [EC:2.8.3.6]
Organism
bsw  Brucella suis ZW043
Pathway
bsw00362  Benzoate degradation
bsw01100  Metabolic pathways
bsw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsw00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    IY71_00430
Enzymes [BR:bsw01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.6  3-oxoadipate CoA-transferase
     IY71_00430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: AIN83417
UniProt: A0A4Z0F496
Position
1:87677..88366
Genome map
AA seq 229 aa AA seqDB search
MTIDTLEDIKLSNAQIAWRAAQDIADGAYVNLGIGFPEMVARYQPEGREAIFHTENGILD
FGEAPPPGEEDWDLINAGKKAVTLKPGAAFFHHADSFSMVRGGHLDVAILGAYQVAQNGD
LANWRVGAKGVPAVGGAMDLVHGAKQVVVITEHVTKKGEPKLVEQCTFPLTGVKCITRIY
TSHAVVDVSEGRFVLREKLAAMTLEELQAMTGAKLHIEGPVADLVVPEL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgatacgcttgaagacatcaagctttccaatgcccagattgcctggcgcgcg
gcgcaggatattgccgacggcgcctatgtgaaccttgggatcggttttcccgaaatggtt
gcccgctatcagccggaaggccgcgaggcgatcttccacaccgaaaacggcattcttgat
tttggcgaagcgccgccgccgggtgaggaagactgggatctgatcaatgcgggcaagaag
gctgtgacgctgaagccgggagcggccttcttccaccatgcagacagtttttccatggtg
cgcggcggccatctcgatgtggcgatcctcggcgcctatcaggttgcgcaaaatggcgat
cttgccaattggcgcgtgggcgcaaagggcgttccggcggttggcggcgcgatggatctc
gttcatggcgcaaaacaggtggtcgtcatcaccgaacatgtcaccaagaagggggaaccc
aagctggtggaacaatgcactttcccgttgacgggtgtgaagtgcattacgcgcatttat
acgagccacgcggtcgtggatgtttccgaaggccgttttgtgctgcgtgaaaagcttgcc
gcgatgacgctggaagagcttcaggctatgaccggcgccaagctgcatattgaaggcccc
gtggccgatcttgtcgttcctgaattgtga

DBGET integrated database retrieval system