KEGG   Brucella suis ZW043: IY71_01615Help
Entry
IY71_01615        CDS       T03426                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
bsw  Brucella suis ZW043
Pathway
bsw00220  Arginine biosynthesis
bsw01100  Metabolic pathways
bsw01110  Biosynthesis of secondary metabolites
bsw01130  Biosynthesis of antibiotics
bsw01230  Biosynthesis of amino acids
Module
bsw_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:bsw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    IY71_01615
Enzymes [BR:bsw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     IY71_01615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N TOC159_MAD
Motif
Other DBs
NCBI-ProteinID: AIN83629
UniProt: A0A4Z0F0T6
Position
1:327136..328074
Genome map
AA seq 312 aa AA seqDB search
MANDNGIKHFIDLSTVPATELRAILEDAKARKARLKAGEVERPYAGKVLAMIFEKPSTRT
RVSFDVGMRQLGGETIMLTGSEMQLGRSEAIADTAKVLSRYVDAIMIRTTAHERMLELAE
YATVPVINALTDDTHPCQIMADVLTYEEHRGPIKGKTFAWMGDGNNVLHSLVEAAARFDF
NVNIATPKGSEPKSQYIDWARANGAGIMSTTDPEKAASGADCIVTDTWVSMGQEDHARGH
NVFIPYQVNANLMAKADPKALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKAI
LAWCLQDRGLGA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacgataacggtatcaaacactttatcgatctctccaccgttccggcgacggag
cttcgcgccattctggaagatgccaaggcgcgcaaggcgcgcctgaaagctggcgaagtc
gaacggccctacgccggcaaggtgctggcgatgatctttgaaaagccttccacgcgtacg
cgcgtttcctttgacgtcggaatgcgccagctcggcggcgaaacgatcatgctgacgggt
tcggaaatgcagcttggccgcagcgaagccatcgccgacacggcgaaggttctctcacgc
tatgtggatgcgatcatgatccgcaccaccgcgcatgaacgtatgctggaactggccgaa
tatgccactgttcccgttatcaatgcgttgaccgacgacacccacccttgtcagatcatg
gcagacgttcttacatatgaggaacatcgcggcccgatcaagggcaagacctttgcctgg
atgggggatggcaacaacgtcctgcattcgcttgtggaagctgcggcgcggtttgatttc
aacgtcaatatcgcgacaccgaaaggcagtgagccgaagtcgcaatatatcgactgggcg
cgggccaacggcgcgggcatcatgtccaccaccgacccggaaaaggcggcaagcggcgca
gattgcatcgtgaccgatacatgggtgtcgatggggcaggaagatcatgcccgtggacac
aatgttttcataccctatcaggtcaatgcgaacctgatggcaaaggctgacccgaaggca
ttgttcatgcactgcctgcccgcgcatcgcggcgaggaagtgaccgatgaagtcatcgac
gggccgcaatcggtcgtgttcgatgaagcggaaaacaggctccacgcccagaaggccatt
ctggcctggtgcctgcaagaccgcggtttgggagcataa

DBGET integrated database retrieval system