KEGG   Brucella suis ZW043: IY71_02925Help
Entry
IY71_02925        CDS       T03426                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bsw  Brucella suis ZW043
Pathway
bsw00970  Aminoacyl-tRNA biosynthesis
bsw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsw00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    IY71_02925
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bsw03029]
    IY71_02925
Enzymes [BR:bsw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     IY71_02925
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     IY71_02925
Mitochondrial biogenesis [BR:bsw03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    IY71_02925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AIN83866
UniProt: A0A2D2BN22
Position
1:583784..585028
Genome map
AA seq 414 aa AA seqDB search
MVGVRDRLEATLARLAARAGEEHVFSKIYAERARAEADAADTRLRAGRPLGPLDGRIVSI
KDLFDVAGEPTLAGSVVRHDAPPAGCDALIVQRLRNAGAVIIGKTHMTEFAFTPVGLNPH
YGEPGNAIDPARIPAALNGLVGFKPTARRIPLEGAFPLAPSLDSVGPLTRTVADAILADA
VMAGEKPILPEVLPVNGLRIALPKDYLLADMEPDVAAHFEASLAALEKAGAIIADLAVDD
LIGRLKEATRIGSIAGIEASHIHASTWLADLDANVDIRVKRPLSVRIKVPLEAYHALMET
RKALAREMDERLSGFDMFATPATPIVAPTIASVSHDEEEYDRVENLLLRDTQVANQFDLC
SITLPMPGMKLPTGLMLTARNDSDKRLLAAALSIEKLLEHDPEKCERFSEKDHA
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggtcggggttcgggatcggttggaagccaccctcgcacggcttgcggcgcgggcgggt
gaggagcacgtcttcagcaagatctatgcggagcgtgcacgggcggaggccgatgcagca
gatacgcggctgcgcgcagggcggccgcttggtccgcttgatggccgcatcgtttcgatc
aaggatctgttcgatgtggcgggcgagccgacgcttgcgggttcggtggttcgccacgat
gccccgcctgcgggctgcgatgctctcatcgtgcagcgcctgcgcaatgccggagcggtt
attatcggcaaaacccacatgaccgagtttgccttcacgccggtcggcctcaatccgcat
tacggtgagccgggcaatgcgattgacccggcgcgcattccggcggcactgaacgggctg
gtcggtttcaagcccaccgcgcggcgcattccgctggaaggcgcctttccgctggcgccg
tcgcttgattcggtcgggccgctcaccagaaccgtggctgatgctatcctggctgatgcg
gtgatggccggggaaaagcccattctgccggaggtcttgccggtgaatgggctgcgtatc
gccttgccgaaagactatctgctcgcggacatggagccagatgtcgcagctcattttgaa
gcgtctctggccgcacttgaaaaggccggagcaatcattgccgatcttgcggtggacgac
ctcatcgggcggctgaaagaggcaacccgcataggttcgattgccggtatagaggcaagc
catattcatgcttccacatggctcgccgatctggacgccaatgtcgatattcgggtcaag
cgcccgctttcggtacgcataaaggtgccgcttgaggcctatcatgcgctcatggaaacg
cgaaaggcactggcgcgtgaaatggatgaacgcctgagtggtttcgatatgttcgcaacg
cctgcaacacctattgttgcgccgacaattgcttccgtcagccacgacgaggaggaatat
gaccgggtggagaacctgcttttgcgcgatacgcaggtcgcaaaccagttcgacctatgc
agcatcaccctgcccatgccgggcatgaaattgccgactggcctcatgctgaccgcacgc
aatgactcggacaagaggctgcttgctgcagccttgtcgattgaaaaattattagagcat
gatcccgaaaagtgtgagcggttttcggaaaaagaccatgcttaa

DBGET integrated database retrieval system