KEGG   Brucella suis ZW043: IY71_07945Help
Entry
IY71_07945        CDS       T03426                                 

Definition
(GenBank) fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bsw  Brucella suis ZW043
Pathway
bsw00051  Fructose and mannose metabolism
bsw01100  Metabolic pathways
bsw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    IY71_07945
Enzymes [BR:bsw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     IY71_07945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AIN84781
UniProt: A0A2D2BVN6
Position
1:1592239..1592898
Genome map
AA seq 219 aa AA seqDB search
MQMNCDSALLARQSIVDAMRSFEEKGFNHGSSGNISVREGGHIWVTPTGATSTMDPQDMS
LVSLEGEHLAGKIPSSEWRIHTEIMRAHPEAGAVVHSHADACVAVLCLRKPLPPFHYMIA
SFGGSEVPCASYRVFGSDALAYEVVRAMGHHRACLMASHGMVVWGRDLAHARLLAEKLET
LARQYILACQIGTPALLSDVELTEVRERYGFYGSQPMPR
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgcagatgaattgcgattcggcccttttggcccgacagtccatcgtggatgcgatgcgg
tcttttgaggaaaagggattcaatcatggcagcagcggcaacatcagtgttcgggaaggc
gggcatatttgggtgacgccaacgggcgcgacctcgactatggacccgcaggacatgagc
cttgtctcccttgaaggcgagcatctggctggcaaaattccctccagcgaatggcgtatc
cataccgaaatcatgcgggcgcacccggaagccggtgccgtggtccattcccacgcagat
gcctgcgtggcggttctctgcctgcgcaagccccttccgccattccattacatgatcgct
tccttcggcgggagcgaggtgccttgtgcgtcatatcgcgtattcggatcggacgcgctg
gcttatgaagtcgtgcgtgcgatggggcaccatcgcgcctgtctgatggcaagccacggc
atggtggtgtgggggcgggatctcgcacatgccaggctccttgcagaaaagctcgaaacg
ctggcacggcaatatatattggcctgccagatcggaacacccgccctgttgagcgatgtc
gaactgacggaagtccgggaacgctacggtttttacggcagccaacccatgccgcgctga

DBGET integrated database retrieval system