KEGG   Brucella suis ZW043: IY71_08300Help
Entry
IY71_08300        CDS       T03426                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
bsw  Brucella suis ZW043
Pathway
bsw00230  Purine metabolism
bsw00250  Alanine, aspartate and glutamate metabolism
bsw01100  Metabolic pathways
Module
bsw_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:bsw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    IY71_08300
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    IY71_08300
Enzymes [BR:bsw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     IY71_08300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AIN84842
UniProt: A0A2D2BQR1
Position
1:complement(1652327..1653616)
Genome map
AA seq 429 aa AA seqDB search
MANVVVVGSQWGDEGKGKIVDWLSERADVIVRYQGGHNAGHTLVIDGVSYKLSLLPSGLV
RGKLSVIGNGVVVDPHHFVAEVEKLRGQGIDVTPDVLRVAENAPLILSIHRELDAMREGS
NSGLKIGTTKRGIGPAYEDKVGRRAIRVIDLTEPETLRPKVERLLAHHNSLRRGMGLEEI
AVETILTELTSVADQILPYIDQVWRVLDERRKAGARILFEGAQGALLDNDHGTYPFVTSS
NTVAGQAAAGSGLGPTAIGYVLGITKAYTTRVGEGPFPTELNDEIGEFLGTKGHEFGVVT
GRKRRCGWFDAVIVRQTVRTSGINGIALTKLDVLDGLEEIKICVAYELDGKRIDYLPSSM
GAQARVKPIYETLPGWSETTAGARSWNDLPAQAVKYVRHIEELIGAPVAMLSTSPEREDT
ILVTDPFHD
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgtggttgtcgtcgggtcgcaatggggcgacgagggcaagggaaagatcgtt
gactggctgtccgagcgtgccgacgtgatcgtgcgctaccagggcggtcataacgcaggt
catacgcttgtcatcgacggtgtcagctacaagctttcgctgctgccatccggcctcgtg
cgcggcaagttgagcgttatcggcaatggcgtcgtggtcgatccgcaccatttcgtcgcc
gaagttgaaaagctgcgcgggcagggcatcgatgtgacgccggatgtgctgcgcgttgcg
gaaaacgcaccgcttatcctttcgatccatcgtgaactcgacgccatgcgcgaaggctcc
aattcaggcctcaagatcggcacgaccaagcgcggcatcggccccgcttacgaagacaag
gttggccgccgcgccatccgcgtgatcgatctgaccgagccggaaacattgcggccgaag
gtggagcgcctgcttgcgcaccataattcgctgcgccgcggcatgggccttgaagaaatc
gccgttgaaaccatcctcaccgaactgacttcggttgccgaccagatcctgccctatatc
gatcaggtctggcgtgtcctggacgagcgccgcaaggctggcgcccgtatcctgtttgaa
ggtgcgcagggcgcgctgctcgacaatgatcacggcacctatccgttcgtgacctcttcc
aacacggttgccggtcaggccgctgccggttccggcctcggccccacggctatcggctat
gtgcttggcatcaccaaggcctatacaacccgcgttggcgaaggtccgttcccgaccgag
ctcaatgacgagatcggcgaattcctcggcaccaagggccatgaattcggcgtggtgacg
ggccgcaagcgccgttgcggctggttcgatgccgtcatcgtgcgccagacagtgcgcact
tccggcatcaacggtattgcacttaccaagctcgatgttctggatggtctggaagaaatc
aagatttgcgtcgcctatgaactcgacggcaagcgcatcgattatctgccgtcttccatg
ggcgcgcaggcccgcgtgaagccgatctacgaaaccttgccgggctggtctgaaacaacc
gccggtgcgcgttcgtggaacgatcttcccgcgcaggcggtcaaatatgtccgccatatc
gaagagctgatcggtgcgccggtggcgatgctctccacaagccccgagcgcgaggatacg
atcctcgtaaccgatccgttccacgactga

DBGET integrated database retrieval system