KEGG   Brucella suis ZW043: IY71_14980Help
Entry
IY71_14980        CDS       T03426                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bsw  Brucella suis ZW043
Pathway
bsw00071  Fatty acid degradation
bsw00072  Synthesis and degradation of ketone bodies
bsw00280  Valine, leucine and isoleucine degradation
bsw00310  Lysine degradation
bsw00362  Benzoate degradation
bsw00380  Tryptophan metabolism
bsw00620  Pyruvate metabolism
bsw00630  Glyoxylate and dicarboxylate metabolism
bsw00640  Propanoate metabolism
bsw00650  Butanoate metabolism
bsw00900  Terpenoid backbone biosynthesis
bsw01100  Metabolic pathways
bsw01110  Biosynthesis of secondary metabolites
bsw01120  Microbial metabolism in diverse environments
bsw01130  Biosynthesis of antibiotics
bsw01200  Carbon metabolism
bsw01212  Fatty acid metabolism
bsw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    IY71_14980
   00630 Glyoxylate and dicarboxylate metabolism
    IY71_14980
   00640 Propanoate metabolism
    IY71_14980
   00650 Butanoate metabolism
    IY71_14980
  09103 Lipid metabolism
   00071 Fatty acid degradation
    IY71_14980
   00072 Synthesis and degradation of ketone bodies
    IY71_14980
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IY71_14980
   00310 Lysine degradation
    IY71_14980
   00380 Tryptophan metabolism
    IY71_14980
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    IY71_14980
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    IY71_14980
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    IY71_14980
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsw04147]
    IY71_14980
Enzymes [BR:bsw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     IY71_14980
Exosome [BR:bsw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IY71_14980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AIN86053
UniProt: A0A2D2BU74
Position
2:complement(780779..781987)
Genome map
AA seq 402 aa AA seqDB search
MAEAYIYDHVRTPRGRGKKDGSLHEVPAVRLGAKVLESLRDRNGIDTAKVDDIIFGCVDP
VGEAGAVIPRSAAFEAGYDFKAPGIQISRFCASGLDAINLAAAKVAFGSDDLVIAGGVES
MSRVGMGMSGGAWYMDPSVGFPGYFMPQGVSADLIATKYGFSRDDVDAYAVESQKRAANS
WEKGYFKNSVITIKDQNGLTILDRDEHMRPGTDMQALGQLNPSFVMPGEMGGFNAVGIQA
HPEIETVNHVHHAGNSSGIVDGAAGVLVGSRKAGKAFDIKPRARIRAFANIGSEPALMLT
GPVDVTEKLLKQAKMKISDIDLFELNEAFAAVVLRYMQAFDIPHDKINVNGGAIAMGHPL
GATGAMILGTVLDELERRNLNTALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggcttatatttacgatcacgtgcgcacgccgcgcgggcgcggcaagaaggac
ggctccctgcacgaagtgcctgccgttcgtctgggcgcgaaggttctggaatccctgcgc
gaccgcaacggcatcgacaccgccaaggtcgatgacattattttcggctgcgtcgatccg
gtcggcgaagcaggcgcggtcattccgcgttcggcggctttcgaggccggttatgatttc
aaggcgccgggcatccagatttcgcgcttctgcgcttcgggccttgatgccatcaatctg
gccgctgccaaggtggcattcggttcggatgatctggtgattgcgggcggcgtggaaagc
atgtcgcgcgtcggcatgggcatgtcgggcggcgcctggtacatggacccatcggttggc
ttccccggctatttcatgccgcagggcgtttccgccgacctgattgccaccaaatacggt
ttcagccgcgatgatgtcgatgcctatgctgtcgaaagccagaagcgcgctgccaattcg
tgggaaaagggctatttcaagaattcggtcatcacgatcaaggaccagaacggcctcacc
attctcgaccgtgacgagcatatgcgccccggcaccgacatgcaggcgctgggccagttg
aacccgtccttcgtgatgccgggcgaaatgggtggcttcaatgctgtcggcattcaggcg
cacccggaaatcgaaaccgtcaaccatgtccaccatgccggcaattcgtcgggcatcgtg
gatggcgcggcgggggttctcgtcggctccaggaaggctggcaaggccttcgatatcaag
ccgcgcgcgcgcattcgtgcttttgccaatatcggttcggaaccggcgcttatgctgacc
ggcccggtcgatgtgacggaaaagctgctgaaacaggccaagatgaagatttcggacatt
gatctgttcgagttgaacgaagccttcgccgcggtggtcctgcgctatatgcaggctttc
gatattccgcacgacaagatcaacgtcaatggcggcgccattgccatgggccatccgctc
ggtgccaccggcgcgatgatcctcggcacggtgctggatgaactggaacgccgcaatctc
aataccgctctggtgacgctgtgcatcggtgccggtatgggcacggccacgatcatcgag
cgcgtgtaa

DBGET integrated database retrieval system