KEGG   Bacillus subtilis XF-1: C663_0944Help
Entry
C663_0944         CDS       T02459                                 

Definition
(GenBank) hypothetical protein
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
bsx  Bacillus subtilis XF-1
Brite
KEGG Orthology (KO) [BR:bsx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsx03009]
    C663_0944
Enzymes [BR:bsx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     C663_0944
Ribosome biogenesis [BR:bsx03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    C663_0944
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 DUF1347
Motif
Other DBs
NCBI-ProteinID: AGE62779
UniProt: M4KWJ5
Position
complement(998700..999608)
Genome map
AA seq 302 aa AA seqDB search
MNQKGRGLEILINEKQDGQWLFSVLKTALKASKPVIQDWMSHQQIKVNHESVLNNMIVKK
GDRVFIDLQESEASSVIPEYGELDILYEDNHMLIVNKPAGIATHPNEDGQTGTLANLIAY
HYQINGETCKVRHVHRLDQDTSGAIVFAKHRLAHAILDQQLEKKTLKRTYTAIAEGKLRT
KKGTINSPIGRDRSHPTRRRVSPGGQTAVTHFKVMAINAKERLSLVELELETGRTHQTRV
HLASLGHPLTGDSLYGGGSKLLNRQALHANKVQAVHPITDELIVAEAPFPADMKNLCRTY
FS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaaaaaggcagagggcttgagatcctcatcaatgaaaaacaagacggccaatgg
ctgttttccgtactcaaaacagcgctcaaagcttctaaaccagtgatacaagactggatg
tcccatcaacagataaaggtcaatcacgaatccgtcttaaacaatatgattgtaaaaaag
ggagaccgcgtgttcattgatcttcaggaaagtgaagcatcttcggtcattccggagtat
ggcgagcttgatattttatatgaggacaatcatatgctcatcgtcaataaacccgctggc
atcgcgacgcatccgaatgaggatgggcaaaccggtacactggctaatttgatcgcttat
cattatcagataaatggcgaaacatgtaaggtgcgccacgtccatcgtcttgatcaggat
acatctggcgctatcgtttttgccaagcatcgtttggcacacgccatcttagaccagcag
ttagagaaaaagacgctgaagcgtacgtataccgccatcgctgaaggtaagctaaggacg
aaaaaagggacaattaattcaccgatcggcagagaccgatcacacccgacaagacgccgg
gtttcaccaggcgggcaaacagccgtcactcatttcaaggtaatggccatcaatgcgaaa
gaacggctgtcgctcgttgaattagagctggaaacaggaagaacccaccaaacccgtgtc
catctggcgagcctcggacatccgttgacaggagactcgctttacggaggcgggagcaag
ctgctaaacaggcaggcactgcacgccaataaagtacaagcggttcaccccataacagac
gagctcatagttgctgaagcccctttccctgctgatatgaaaaacctttgccgcacatat
ttttcatga

DBGET integrated database retrieval system