KEGG   Bacillus subtilis XF-1: C663_1059Help
Entry
C663_1059         CDS       T02459                                 

Gene name
yhfS
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bsx  Bacillus subtilis XF-1
Pathway
bsx00071  Fatty acid degradation
bsx00072  Synthesis and degradation of ketone bodies
bsx00280  Valine, leucine and isoleucine degradation
bsx00310  Lysine degradation
bsx00362  Benzoate degradation
bsx00380  Tryptophan metabolism
bsx00620  Pyruvate metabolism
bsx00630  Glyoxylate and dicarboxylate metabolism
bsx00640  Propanoate metabolism
bsx00650  Butanoate metabolism
bsx00900  Terpenoid backbone biosynthesis
bsx01100  Metabolic pathways
bsx01110  Biosynthesis of secondary metabolites
bsx01120  Microbial metabolism in diverse environments
bsx01130  Biosynthesis of antibiotics
bsx01200  Carbon metabolism
bsx01212  Fatty acid metabolism
bsx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsx00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    C663_1059 (yhfS)
   00630 Glyoxylate and dicarboxylate metabolism
    C663_1059 (yhfS)
   00640 Propanoate metabolism
    C663_1059 (yhfS)
   00650 Butanoate metabolism
    C663_1059 (yhfS)
  Lipid metabolism
   00071 Fatty acid degradation
    C663_1059 (yhfS)
   00072 Synthesis and degradation of ketone bodies
    C663_1059 (yhfS)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C663_1059 (yhfS)
   00310 Lysine degradation
    C663_1059 (yhfS)
   00380 Tryptophan metabolism
    C663_1059 (yhfS)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    C663_1059 (yhfS)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C663_1059 (yhfS)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    C663_1059 (yhfS)
Enzymes [BR:bsx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     C663_1059 (yhfS)
Exosome [BR:bsx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   C663_1059 (yhfS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGE62888
UniProt: M4KQ60
Position
complement(1114052..1115146)
Genome map
AA seq 364 aa AA seqDB search
MNAVIVDAKRTIFGNQNGLLKPFLPEDLAAPIIRCLSRKLEDQIDEVILGNATGRGGNLA
RLSALQAGLPLSVPGMTIDRQCGSGLEAVRYACSLIQAGAGTMYIAGGSESSSQSPFSER
ARFSPDAIGDPDMGIAAEYTAARYSISRNMQDEYALLSHQRSRNAHDGGFYREEIVPLGE
LETDEAFLKTRPIKAIIPRAKPVFDTSSGTVTAANSSGIADGAAALLVMKEEKAAALGLK
PVLRFIGSAVSGIHPNYPPAAPVDAIRNLLHTHDVTPDDIGLFEINEAFAVKICVCSQEL
GIPFSKINVRGGALALGHPYGASGAALVTRLFYEAKRRTDCQYAVAAIGSGGGIGLALLF
EVLA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccgttattgttgatgcaaaacgaacgatctttggaaatcaaaacggactgctg
aagcccttcctgccggaggatttggcggctcccatcatccgctgtctcagccgaaagcta
gaggatcaaattgacgaggtcattctcggaaatgctaccggcagaggcggcaacctcgcc
agactgtcagcccttcaagccggactgcctttatcggttcccggaatgacaattgacaga
cagtgcggctccggccttgaagctgtgcgctatgcctgcagccttattcaagcgggagcc
ggcacgatgtatatcgcgggcggctcagaaagcagcagccaatcccctttttcagaacgg
gcccgcttttctccagatgccatcggcgatcccgacatgggaatcgcagcagaatatacg
gcagcacgttattccatcagcagaaacatgcaggatgagtacgcgcttctcagccatcaa
cgcagcaggaacgcgcatgatggaggattttaccgtgaagaaattgttcctctcggggaa
ttggagacagacgaagcatttttgaaaacacgtccgataaaagcgattattccccgcgca
aagccggttttcgacaccagctccggaacagtcacagcagccaacagcagcggcatagca
gacggagcagcggctcttttggtaatgaaagaagaaaaagcggcagccctgggacttaag
cctgtgctccggtttatcggcagcgcagtcagcgggattcatcccaactatccgcccgcg
gctccggttgatgcgatccgtaatctcttacatacacacgatgtaacacctgatgatatc
ggtttatttgaaatcaatgaagcctttgccgtcaaaatttgtgtctgctcgcaagaactc
ggcattcccttttcaaaaatcaatgtgcgcggcggcgcattagctcttggccatccatac
ggtgcatcaggtgcagctctggtaaccagattgttttatgaagcgaaaagacggacagac
tgtcaatatgctgttgcagccatcggaagcggcggcggaatcgggctggctttattattt
gaagttcttgcatag

DBGET integrated database retrieval system