KEGG   Bacillus subtilis XF-1: C663_2298Help
Entry
C663_2298         CDS       T02459                                 

Gene name
mmgA
Definition
(GenBank) degradative acetoacetyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bsx  Bacillus subtilis XF-1
Pathway
bsx00071  Fatty acid degradation
bsx00072  Synthesis and degradation of ketone bodies
bsx00280  Valine, leucine and isoleucine degradation
bsx00310  Lysine degradation
bsx00362  Benzoate degradation
bsx00380  Tryptophan metabolism
bsx00620  Pyruvate metabolism
bsx00630  Glyoxylate and dicarboxylate metabolism
bsx00640  Propanoate metabolism
bsx00650  Butanoate metabolism
bsx00900  Terpenoid backbone biosynthesis
bsx01100  Metabolic pathways
bsx01110  Biosynthesis of secondary metabolites
bsx01120  Microbial metabolism in diverse environments
bsx01130  Biosynthesis of antibiotics
bsx01200  Carbon metabolism
bsx01212  Fatty acid metabolism
bsx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C663_2298 (mmgA)
   00630 Glyoxylate and dicarboxylate metabolism
    C663_2298 (mmgA)
   00640 Propanoate metabolism
    C663_2298 (mmgA)
   00650 Butanoate metabolism
    C663_2298 (mmgA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C663_2298 (mmgA)
   00072 Synthesis and degradation of ketone bodies
    C663_2298 (mmgA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C663_2298 (mmgA)
   00310 Lysine degradation
    C663_2298 (mmgA)
   00380 Tryptophan metabolism
    C663_2298 (mmgA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    C663_2298 (mmgA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C663_2298 (mmgA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    C663_2298 (mmgA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsx04147]
    C663_2298 (mmgA)
Enzymes [BR:bsx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     C663_2298 (mmgA)
Exosome [BR:bsx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   C663_2298 (mmgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGE64068
UniProt: M4KTH9
Structure
PDB: 

Position
complement(2365731..2366912)
Genome map
AA seq 393 aa AA seqDB search
MRKTVIVSAARTPFGKFGGVLKEVKAAELGGIVMKEALQRAGVSGDDVEGNVMGMVVQAG
SGQIPSRQAARLAGMPWSVPSETLNKVCASGLRAVTLCDQMIRAQDADILVAGGMESMSN
IPYAVPAGRWGARMGDGELRDLMVYDGLTCAFDEVHMAIHGNTAAKDYAISRREQDEWAL
RSHARAAKAADEGKFQDEIVPVNWIGRKGKPNVVHKDEAIRRDTSLDQLAKLAPIYASDG
SITAGNAPGVNDGAGAFVLMSEEKAAELDKRPLATILGFSTVGMPAHELAAAPGFAINKL
LKKNGLTVQDIDLFEVNEAFASVVLTCEKIVGFDLEKVNVNGGAIALGHPIGASGARILM
TLVYELKRRGGGLGVAAICSGAAQGDAVLVQVH
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaaacagtcattgtaagtgctgcaagaacgccatttggcaaattcggcggagta
ttgaaagaggtgaaagctgctgagcttgggggcattgtgatgaaggaggcgctgcaacgg
gctggagtctctggagatgatgtagaaggaaacgttatgggcatggttgtccaggccggc
tcagggcagataccttcccgtcaagctgcccgtctggcgggaatgccttggagtgtgccg
tcagaaacactgaataaagtctgcgcttccggccttcgcgctgtcactttatgtgatcaa
atgattcgggcgcaggatgcggacatacttgttgccgggggaatggaaagcatgagcaat
atcccgtatgccgttcccgccgggcgctggggagcacggatgggggacggcgagcttagg
gacttaatggtgtatgacggattaacgtgcgcgtttgacgaggtgcacatggctattcac
ggaaatacagcggccaaggattatgcaatctcacgaagagagcaggacgaatgggcgttg
agaagtcacgcaagggcagctaaggcagccgatgaagggaagtttcaggatgaaattgtt
cccgtcaactggatcggtcgaaaaggaaaaccaaacgttgttcataaagatgaagcgatt
cgccgtgacacaagtctggatcagctcgcgaaacttgctccgatttatgcaagtgacggt
tctatcacagccggcaatgctcctggggtcaatgacggagccggcgcgtttgtgctgatg
tctgaggaaaaagctgctgagcttgacaaacggcctctggctacaattcttggtttttca
actgtgggaatgccagcgcacgagctggcggcagcgccggggtttgcaattaacaagctc
ctgaaaaagaacggtttaactgtccaagatattgacttgtttgaagtaaatgaagctttt
gcttcagttgttttgacatgtgaaaaaatcgtaggtttcgatcttgaaaaagtaaatgta
aatggcggtgcgatcgcgctcggccacccgatcggcgcgagcggggcaagaattctcatg
acgcttgtttatgaattaaagcgacggggagggggtctgggcgttgccgctatttgcagc
ggggcagcacagggagacgccgtcttagtgcaggttcattaa

DBGET integrated database retrieval system