KEGG   Bacillus subtilis XF-1: C663_3087Help
Entry
C663_3087         CDS       T02459                                 

Gene name
nagD
Definition
(GenBank) putative p-nitrophenyl phosphatase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
bsx  Bacillus subtilis XF-1
Pathway
bsx00627  Aminobenzoate degradation
bsx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsx00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    C663_3087 (nagD)
Enzymes [BR:bsx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     C663_3087 (nagD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like HAD_2 Hydrolase Hydrolase_3 Acid_phosphat_B
Motif
Other DBs
NCBI-ProteinID: AGE64824
UniProt: M4KZV7
Structure
PDB: 

Position
complement(3130289..3131059)
Genome map
AA seq 256 aa AA seqDB search
MKTYKGYLIDLDGTMYNGTEKIEEACEFVRTLKDRGVPYLFVTNNSSRTPKQVADKLVSF
DIPATEEQVFTTSMATAQHIAQQKKDASVYVIGEEGIRQAIEENGLTFGGENADFVVVGI
DRSITYEKFAVGCLAIRNGARFISTNGDIAIPTERGLLPGNGSLTSVLTVSTGVQPVFIG
KPESIIMEQAMRVLGTDVSETLMVGDNYATDIMAGINAGMDTLLVHTGVTKREHMTDDME
KPTHAIDSLTEWIPYI
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatataaagggtatttaattgatttagacggaacgatgtacaatggcacggaa
aaaatcgaggaagcgtgtgaatttgtcagaacgctgaaagatcgcggcgttccttatctt
ttcgtgacaaacaactcttcgcgcacaccgaagcaggtagcggacaagctcgtgtctttt
gatattccggcaacagaagagcaggtcttcacgaccagcatggcaactgcccagcacatt
gcacagcagaaaaaagacgcgtctgtgtatgtgattggggaggaaggaatccgccaggcg
attgaagaaaacggcctgacatttggcggagaaaacgcggactttgtcgttgttggcatc
gatcgttccattacatacgaaaaatttgctgtcggctgcctggcaatcagaaatggtgcc
cgctttatttccactaatggagatattgcgattccgactgaaagagggcttctgccggga
aacggttcactgacatcggtgttaaccgtatctacaggtgtacagcctgtatttatcggc
aagccggaatcaattattatggagcaggcgatgcgcgttctcggcacagatgtgtctgaa
acactcatggttggcgacaactacgccactgatattatggccggcattaacgcgggtatg
gatacgctgctcgttcacacaggcgtaacgaaaagagaacatatgacagacgatatggaa
aaaccgactcacgccattgactctctgactgaatggattccatacatttga

DBGET integrated database retrieval system